KEGG   Streptomyces albus DSM 41398: SLNWT_5701Help
Entry
SLNWT_5701        CDS       T03823                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00020  Citrate cycle (TCA cycle)
sals00310  Lysine degradation
sals00380  Tryptophan metabolism
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01120  Microbial metabolism in diverse environments
sals01130  Biosynthesis of antibiotics
sals01200  Carbon metabolism
Module
sals_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sals_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLNWT_5701
  09105 Amino acid metabolism
   00310 Lysine degradation
    SLNWT_5701
   00380 Tryptophan metabolism
    SLNWT_5701
Enzymes [BR:sals01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLNWT_5701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJE86077
UniProt: A0A0B5F6T5
Position
complement(6618242..6620023)
Genome map
AA seq 593 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEQDEPLLEVSTDKVDTEIPSPAAGTLSSIK
VAEDETVEVGAELALIDDGSGAPAEAPAPAAEQAPEPEPEQPAQPAEAEQPAPAAEAPAQ
SSSGGGSAEGTDVTLPALGESVTEGTVTRWLKQVGDSVEADEPLLEVSTDKVDTEIPAPV
AGTLLEITVNEDETAEVGAKLAVIGAEGAAPAAPKQEAPAAPAPAQEAPAEEKPAPAPAP
APAPAAEKPAPAPEKPAPAPAQPAAPAPAPAAQAPAAPAPARSAGDEGAYVTPLVRKLAA
ENGVDLGSVKGTGVGGRIRKQDVLAAAEAAKSAAPAPAAAPSAPKTPALETSPLRGQTVK
MTRMRKVIGDNMMKALHEQAQLTSVVEVDITKLMKLRGRAKDSFAAREGVKLSPMPFFVK
AAAQALKAYPVVNARINESEGTITYFDSENIGIAVDSEKGLMTPVIKRAGDLNLAGIAKA
TAELAGKVRGNKITPDELSGATFTISNTGSRGALFDTIIVPPGQVAILGIGATVRRPVVV
DHPDLGETIAIRDMTYVALSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcacagtcacc
cgctggctgaaggccgagggcgagcgcgtcgaacaggacgagccgttgctggaggtctcg
accgacaaggtcgacaccgagatcccctcgcccgccgcgggcaccctgtcctccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgaactggccctcatcgacgacggctcc
ggcgcgcccgccgaggcccccgccccggccgccgagcaggccccggagcccgagccggag
cagcccgcgcagcccgccgaggccgagcagcccgcgcccgccgccgaggccccggcgcag
tcgtcctccggcggcggttccgccgagggcaccgacgtgaccctgccggcgctcggcgag
tccgtcaccgagggcaccgtgacccgctggctgaagcaggtcggcgacagcgtcgaggcg
gacgagccgctgctcgaggtgtccaccgacaaggtcgacaccgagatcccggccccggtc
gccggcaccctcctcgagatcaccgtgaacgaggacgagaccgccgaggtcggcgccaag
ctcgcggtgatcggtgccgagggcgccgccccggccgccccgaagcaggaggccccggcc
gctcccgcccccgcgcaggaggccccggccgaggagaagcccgccccggctccggctccg
gctccggctccggccgccgagaagcccgccccggctcccgagaagccggctcccgccccg
gcccagcccgcggctcccgctcccgccccggccgcgcaggctccggcggctccggccccg
gcgcgctccgccggtgacgagggcgcgtacgtcaccccgctggtgcgcaagctcgccgcc
gagaacggtgtcgacctgggctcggtcaagggcaccggcgtcggtggccgcatccgcaag
caggacgtgctcgccgcggccgaggccgccaagagcgccgctccggctccggccgccgcc
ccgtccgcgccgaagaccccggccctggagacctctccgctgcgcggccagacggtcaag
atgacccggatgcgcaaggtcatcggcgacaacatgatgaaggcgctgcacgagcaggcc
cagctgacctcggtcgtcgaggtcgacatcaccaagctgatgaagctgcgcggccgggcc
aaggactccttcgccgcccgcgagggcgtcaagctgtccccgatgcccttcttcgtgaag
gccgcggcccaggcgctgaaggcctacccggtcgtcaacgcccggatcaacgagtccgag
ggcaccatcacctacttcgactccgagaacatcgggatcgcggtggactccgagaagggc
ctgatgaccccggtcatcaagcgggcaggcgacctcaacctcgccggtatcgccaaggcc
accgcggagctggcgggcaaggtccgcggcaacaagatcaccccggacgagctgtccggc
gcgaccttcaccatctccaacaccggttcgcgcggcgccctgttcgacacgatcatcgtg
ccgccgggccaggtcgcgatcctgggcatcggcgccaccgtgcgccgcccggtcgtggtg
gaccaccccgacctcggcgagaccatcgcgatccgcgacatgacctacgtcgcgctctcc
tacgaccaccgtctggtggacggcgccgacgccgcccgctacctgacggccgtcaaggcg
atcctggaagcaggagagttcgaggtcgagctggggctgtga

DBGET integrated database retrieval system