KEGG   Streptomyces albus DSM 41398: SLNWT_6551Help
Entry
SLNWT_6551        CDS       T03823                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00051  Fructose and mannose metabolism
sals00520  Amino sugar and nucleotide sugar metabolism
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SLNWT_6551
   00520 Amino sugar and nucleotide sugar metabolism
    SLNWT_6551
Enzymes [BR:sals01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SLNWT_6551
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SLNWT_6551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_II PGM_PMM_I NTP_transf_3 Hexapep PGM_PMM_III Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AJE86927
UniProt: A0A0B5F8X2
Position
7533920..7536400
Genome map
AA seq 826 aa AA seqDB search
MAGGEGTRLRPMTASMPKPLLPVANRPIMEHVLRLLKRHGLNETVVTVQFLASLVKNYFG
DGDELGMELSYANEEKPLGTAGSVKNAEEALKDDAFLVISGDALTDFDLTELINFHKEKG
ALVTVCLTRVPNPLEFGITIVDENGKVERFLEKPTWGQVFSDTVNTGIYVMEPEVFDYVE
ADTSVDWSGDVFPQLMKEGKPIYGFIAEGYWEDVGTHESYVKAQADILEGKVDVELDGFE
ISPGVWVAEGAEVSPEAVLRGPLYIGDYAKVEAGVEIREHTVVGSNVVVKTGAFLHKAVV
HDNVYVGQQSNLRGCVVGKNTDIMRAARIEDGAVIGDECLIGEESIIQGNVRVYPFKTIE
AGAFVNQSVIWESRGQAQLFGARGVSGILNVEITPELVVRLAGAYATTLKKGSTVTTARD
HSRGARALKRAVISALQASAIDVRDLENVPLPVARQQTARGSAGGIMIRTSQGVPDSVDI
MFFDGDGADLSQASQRKLDRVFSRQEYRRAFPGEIGDLRFPASVFDSYTGSLLRDVDTSG
VAESGLKIVVDASNGSAGLVLPSLLGKLGVDALTINPGLDESRPTETADTRRAGLLRLGE
IVASARADFGVRFDPVGERLSLVDEKGRIIEDDRALLVLLDLVAAERRSGRVALPVTTTR
VAEQVAAYHGTQVEWTTTSPDDLTRVGREDQTIFGGDGRGGFIVPEFSSVFDGTAAFVRL
IGLVARTQLTLSQIDARIPRAHVLRRDLATPWAVKGLVMRTVVEAAGDRSVDTTDGVRVV
EADGRWVMVLPDPAEAVTHLWAEGPDDASAQALLDEWSAVVDSAGR
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggccggaggcgagggcacacgccttcgtcccatgaccgcaagtatgcccaagccgctc
cttccggtggccaatcggccgatcatggagcacgtgctgcggctgctcaaacgacatggg
ctcaatgagaccgtggtcacagtgcagttcctggcctccctggtcaagaactatttcggg
gacggcgacgaactcggcatggagctgagctacgccaacgaggagaagccgctcggcacc
gcgggaagcgtcaagaacgccgaagaggccctcaaggacgacgccttccttgtcatctcg
ggtgacgcgctgacggacttcgatctgaccgagctgatcaatttccacaaggagaagggc
gcgctcgtcaccgtctgtctgacgcgcgtaccgaatcccctggaattcggaatcaccatt
gtcgacgagaacggcaaggtcgagcgtttcctggagaagccgacctggggccaggtcttc
tcggacacggtgaacaccggtatctacgtcatggagccggaggtcttcgactacgtcgag
gccgacacctccgtcgactggtcgggcgatgtcttccctcagctcatgaaggagggcaag
ccgatctacggcttcatcgccgaggggtactgggaggacgtcggcacccacgagagctat
gtgaaggcgcaggccgacatcctcgagggcaaggtcgacgtcgagctcgacggcttcgag
atctccccgggcgtctgggttgccgagggcgccgaggtcagcccggaggcggtgctgcgg
ggcccgctctacatcggtgactacgccaaggtcgaggccggcgtcgagatccgggagcac
accgtcgtcggctccaacgtggtcgtcaagacgggcgccttcctgcacaaggcggtcgtg
cacgacaacgtctacgtgggccagcagagcaacctccgcggctgcgtggtcggcaagaac
accgacatcatgcgggccgcgcggatcgaggacggcgccgtcatcggcgacgagtgcctg
atcggcgaggagtcgatcatccagggcaacgtgcgggtctacccgttcaagaccatcgag
gcgggcgccttcgtcaaccagtcggtgatctgggagtcccgcggccaggcccagctcttc
ggcgcccgcggtgtctccgggatcctcaatgtcgagatcaccccggagctggtggtgagg
ctggcgggggcgtacgcgaccaccctgaagaagggctccaccgtcacgacggcccgtgac
cactcgcgaggcgcccgcgcgctcaagcgcgccgtcatctcggcgctccaggccagcgcc
atcgacgtacgggacctggagaacgtcccgctgcccgtggcccggcagcagaccgcgcgg
ggcagcgccggcgggatcatgatccgtacgagccagggcgtgcccgactccgtggacatc
atgttcttcgacggcgacggggccgacctctcgcaggccagtcagcgcaagctcgaccgg
gtgttctcgcggcaggagtaccgcagggccttccccggggagatcggggacctgcgcttc
cccgccagcgtcttcgactcgtacaccggctcgctgctgcgggacgtggacacctccggg
gtcgccgagtccgggctgaagatcgtcgtggacgcctccaacggcagcgcgggcctcgtc
ctgccgagcctgctcggaaagctcggggtggacgcgctgaccatcaaccccggcctggac
gagtcccgtccgaccgagacggccgacacccgcagggcggggctgctgcgcctcggcgag
atcgtggcctcggcccgtgccgacttcggggtgcgcttcgacccggtgggcgagcgcctg
tccctggtggacgagaaggggcggatcatcgaggacgaccgggcgctgctcgtgctcctc
gacctggtggccgccgagcgccgcagcgggcgggtggcgctgccggtgacgacgacccgg
gtcgccgagcaggtggccgcgtaccacggcacccaggtggagtggacgaccacctcgccc
gacgacctcacgcgggtcggccgcgaggatcagacgatcttcggcggagacgggcgcggc
ggcttcatcgtgcccgagttcagcagcgtcttcgacgggacggcggccttcgtacggctc
atcgggctggtcgcgcgtacccagttgacgctcagtcagatcgatgcgcgcatcccgcgg
gcgcatgtgctgcgccgcgatctcgccactccctgggcggtcaagggcctggtgatgcgc
accgtcgtggaggccgccggagaccgctccgtggacaccacggacggggtgcgggtggtc
gaggcggacgggcgctgggtgatggtgctgcccgaccccgcggaggccgtcacccacctc
tgggcggaggggccggacgacgcctccgcgcaggccctgctcgacgagtggtcggcggtc
gtggacagcgccgggcgctga

DBGET integrated database retrieval system