KEGG   Salegentibacter sp. T436: AO058_08265Help
Entry
AO058_08265       CDS       T04614                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
salt  Salegentibacter sp. T436
Pathway
salt00020  Citrate cycle (TCA cycle)
salt00620  Pyruvate metabolism
salt01100  Metabolic pathways
salt01110  Biosynthesis of secondary metabolites
salt01120  Microbial metabolism in diverse environments
salt01130  Biosynthesis of antibiotics
salt01200  Carbon metabolism
Module
salt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:salt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AO058_08265
   00620 Pyruvate metabolism
    AO058_08265
Enzymes [BR:salt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AO058_08265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase DUF4027 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APS38863
UniProt: A0A1L6R2V5
Position
complement(1880956..1882458)
Genome map
AA seq 500 aa AA seqDB search
MNQKVLKENNYDLICVGGGIMSATLALMLKLIDPKIKIIIFEKLGEVSKESSGAWNNAGT
GHSALCELNYTPENADGSIDISKAIEIFSQFETSKQFWAYLVDQKLIKDPENFIHSVPHH
SWVQGDDNINFLKKRFEILSQTPMFEKMKFSEDSEKLKEWIPLITKGRENEKMAATRMEI
GTEVNFETLSQQYFKVLEEQFDVPVLRNTDVLDVDPDETLEWTVEAQNLDSGKVTYYDAE
HVFIGAGGGALPLLQKVEIEEKDGYGGFPVDGQWLVCKNREVIDQHWAKVYSKAGPDAPP
MSTPHLDTRYINGKKELLFGPFAGFTTKFLKEGSKLDLPKSINKENIPSMWGVFWHNLPL
TKYLMKQVTMDHSDRMEDLRVFIKDARPEDWELKVAGKRVQIIKKDEEQGGILEFGTDVV
HSKDGSITALLGASPGASVAVSIMLNVINIAFPEKIKSEKWQEKLSKMIPFWNKEIEENI
TEFKKVQANSSKKLELEVLH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaagtactaaaagagaataactacgatcttatttgtgtaggtggcggtatt
atgagcgctacactcgctttaatgttgaagttaatagatcctaaaatcaaaataattatt
tttgaaaagctgggcgaagtatctaaagaaagttctggcgcgtggaataatgccggcacc
gggcattcggcactttgtgaacttaattataccccagaaaatgctgatggtagcatagat
attagtaaagcaatcgaaatttttagtcagtttgaaaccagcaaacaattttgggcttac
ctggtagaccaaaagcttataaaagatcctgaaaactttattcattcagttccacatcat
agctgggtgcagggagatgataatatcaattttcttaaaaaacgatttgaaattctttcc
caaacacccatgtttgagaaaatgaaattttctgaagattcagagaaattaaaagaatgg
attcccttaattacgaaaggccgtgagaatgagaaaatggctgcaacgcgaatggaaatt
ggcactgaagttaattttgaaacactctcacaacaatattttaaagttctggaagaacaa
tttgatgtaccggttttaagaaataccgatgttttagatgtagatcccgatgaaaccctg
gaatggacggtagaagctcaaaatctagattcaggtaaagttacatattatgatgccgaa
catgtttttataggggccggcggcggcgcattgccactactacaaaaagtagaaatagag
gaaaaagacgggtatggtggattccctgtagatggccagtggctggtttgcaaaaaccgg
gaagttatagaccaacattgggctaaggtttacagtaaagcaggaccagatgctccccca
atgtctactcctcaccttgatacgagatatattaatggaaagaaggaattactttttggg
ccctttgccggtttcacaactaaattcttaaaagaaggttctaaattagatcttccaaaa
agtataaataaagaaaatattccttctatgtggggagttttttggcataatttaccgctt
acaaaatacctgatgaaacaagtcactatggatcattcagaccgaatggaagatcttagg
gtttttataaaagacgccaggccggaagactgggaattaaaagtagcaggaaaacgggtt
caaattattaaaaaagatgaagaacagggtggaattctggaatttggaaccgatgtagtt
cacagcaaagatggttctattaccgctttactgggcgcctcgccgggagcttcagtagcg
gtttctataatgctgaatgtaattaatattgcttttcctgagaaaataaaatctgaaaaa
tggcaggaaaaactttcaaaaatgattcctttctggaataaagaaattgaagaaaatata
actgaatttaaaaaagtacaggcaaattcttctaaaaaactggagttggaggttttacat
taa

DBGET integrated database retrieval system