KEGG   Salegentibacter sp. T436: AO058_15205Help
Entry
AO058_15205       CDS       T04614                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
salt  Salegentibacter sp. T436
Pathway
salt00670  One carbon pool by folate
salt01100  Metabolic pathways
salt01120  Microbial metabolism in diverse environments
salt01200  Carbon metabolism
Module
salt_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:salt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AO058_15205
Enzymes [BR:salt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AO058_15205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31 AAA_26
Motif
Other DBs
NCBI-ProteinID: APS40142
UniProt: A0A1L6R6K8
Position
complement(3448288..3449970)
Genome map
AA seq 560 aa AA seqDB search
MTTTPLTDLEIAQKIELKPITEIAKKLALDAEEIEMYGKYKAKLPLNRINKEKIKNNNLI
LVSAISPTPAGEGKTTVSIGLSEALNQLGKKTTVVLREPSLGPVFGIKGGATGGGFSQVL
PMEDINLHFTGDFSAIEKAHNLLAALVDNNIQSKINNLGLDPRTISLKRVMDVNDRALRN
IVIGLGGTGSGIPRESGFDITSASEIMAIMCLAENLDDLKGRLGNIFIGYTYGKKPIFAR
DLNAEGAMATLLKDALKPNLVQTIEGNPAIIHLGPFANIAQGTNSVIATRMGMSLSDYTV
TEAGFGFDLGAEKFLDIKCQSAGLAPKVVVMTTTIRALKYHGGADLKTLTIPNVEALING
LPNLEKHLENAKLYNITPVIAINRFYSDSDEEIQVIFDLAQKLNIKVALSDGWAKGGAGA
LDLAAKVIEAIEENSSDFKPLYKWEQDVVTKIETIAKKIYGANRVEFSPKAKKNLKTILD
LGLEELPVCIAKTQKSLSDNPALLGRPTGFTLTVREIEIAAGAGFLIPITGDMMRMPGLP
VHPASENITVDLEGNISGLV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaacaccacttaccgatcttgaaattgctcaaaagattgagttaaaacctatt
actgaaattgccaaaaaattagcccttgatgctgaagaaattgaaatgtacggaaagtac
aaagccaaacttccgctaaatagaattaataaagaaaagataaaaaataacaaccttatc
ctggtttctgcaatttcgccaactcctgctggtgaagggaaaacaacggtttctatagga
ctgtctgaagctttaaaccaacttggcaaaaaaactacagtagttttgcgtgaaccttct
ttaggtcctgtttttggtattaaaggtggtgccacaggaggaggtttctcccaggttctt
cctatggaagatataaaccttcattttacgggagatttttcagcgatagaaaaagctcat
aatcttcttgctgccctggtagataataatattcagtcaaaaataaataatctgggactc
gaccctcgtactatttcgcttaaaagagtgatggatgtcaacgatcgtgcgcttagaaat
attgtaattggacttggaggaacaggatctggaattccgcgggagagtggatttgacatt
acttcggcttcagaaattatggccataatgtgccttgccgaaaacctggacgatttaaaa
ggacgtttaggaaatatttttattggttatacttatggaaaaaagccaatttttgcacga
gatcttaatgctgaaggtgcaatggcgaccttactcaaagacgcgcttaaaccaaacctg
gtacaaactattgaaggtaatcccgcaattattcatttaggtccttttgcaaatattgcc
cagggaaccaactcagttattgccacgcgaatggggatgagcctttcagattatacggtg
accgaggctggttttggctttgatcttggtgcagaaaaatttcttgatattaaatgccaa
agcgctggtttggcgcctaaagtggtggtaatgaccactactattagggctcttaagtat
cacggtggagcggatttaaaaacacttacaattcctaatgttgaggctttaattaatggg
cttcccaaccttgagaaacacctggagaatgcaaaattgtataatataacccccgttatt
gccattaacaggttttatagtgatagcgatgaagaaatacaggttatttttgatttggcc
caaaaattaaatattaaggttgctctttctgatggttgggcaaaaggtggagcaggagcg
ttagacctggcggccaaagtaatagaagctatagaagaaaatagttctgattttaaaccc
ctgtacaaatgggagcaggatgtggtgactaaaattgaaactattgcgaaaaaaatatat
ggggctaatagggtagaattttcacctaaagcaaagaaaaacctgaagactattttagat
ctgggactggaagaattgccagtttgtattgcaaaaactcaaaaatcattatcagataat
ccggcgctattaggaagaccaacaggatttacactcactgttagggagattgaaattgct
gccggtgcaggctttcttattcctataaccggtgatatgatgcgaatgccgggattacca
gtacatcccgcttcagaaaatataacagtagatttggaaggaaatatttcggggctggtt
taa

DBGET integrated database retrieval system