KEGG   Streptomyces albulus NK660: DC74_2019Help
Entry
DC74_2019         CDS       T03082                                 

Definition
(GenBank) 5'-nucleotidase domain-containing protein
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00230  Purine metabolism
salu00240  Pyrimidine metabolism
salu00760  Nicotinate and nicotinamide metabolism
salu01100  Metabolic pathways
salu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DC74_2019
   00240 Pyrimidine metabolism
    DC74_2019
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DC74_2019
Enzymes [BR:salu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     DC74_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AIA02529
UniProt: A0A059VT21
Position
complement(2290822..2292792)
Genome map
AA seq 656 aa AA seqDB search
MRDIGRRSFVTAAGAMATASAIGTNAYATGHARDAATADEYVDVQLLNITDLHGYLQGAP
GANSVITGAGGKRYTVGGVAYMAAHLERLRAGRRNSLFFAPGDLFSGWEFDAASFADEPT
IEALNALQLDFASAGNHEFDKSTVFLKEHMERGRAFPVVGRDVSFTDSTGHRFRGANFPY
YSANMVWHDTGQRVLPPYNIVHVDAGRGRRLPIGFIHLTAIGTESFPGSYQPGLRTLDEL
ETANRCAAALKSRGVNAIVLSMHDGAVAGSNFESGTNPSGPAYELALRVSPLIDAIVTGH
WHCAFTMMLPDPKGVPRPFVEAGCYGQIINEINLRLDPVSGKAIRELTTSVNHPNTRDVT
PDPELKSIADYWAGYGARRARTRIGTQTASFTRRRNAVGESTMGNLVADWALWAGGQPHG
PLDDRGGHRNVPAELAVIALAPRVGAAIIGGDLVRDEASDGVVTFGQAWNAVGFGDPIMT
VTVTGRQLHDALEQQWASTAGEGLSFSPLAVSGNVRYTFDAAGRAGHRIDPADVRIDGKP
LDLTRRYRLAAPSYTLINQDGFSAFTGFTDPVRHTRDFESFIAYVRSRRRLSPSELNRIT
VKNAHLAGARVGSVAEHQQLLQADGDRIPRPEEALRKALAGDAEGQRAPGGFRVPC
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacatcggacgacggtccttcgtaaccgccgcgggggcgatggccaccgcgagc
gcgatcggcaccaacgcctacgccaccggccacgcccgcgacgccgccacggccgacgag
tacgtcgacgtccaactgctcaacatcaccgatctgcacggctatctgcagggcgccccg
ggcgccaattccgtcatcaccggcgccggcggcaagcgctacaccgtcggcggcgtcgcc
tacatggccgcccacctggagcggctgcgcgccggacggcgcaactccctcttcttcgcc
cccggcgacctcttctccggttgggagttcgacgccgcctccttcgcagacgaacccacc
atcgaggccctcaacgccctccagttggacttcgcctcggccggcaaccacgagttcgac
aagtcgacggtcttcctgaaggaacacatggaacgcggccgggcgttccccgtcgtcggc
cgcgacgtctccttcaccgactccaccggccaccgcttccgcggcgcgaacttcccctac
tacagcgccaacatggtgtggcacgacaccggccagcgggtgctgccgccgtacaacatc
gtgcacgtggacgccggccggggccgccggctgccgatcggcttcatccacctgaccgcc
atcggcaccgagtccttccccggctcctaccagcccggcctgcgcaccctggacgaactg
gagaccgccaaccgctgcgcggcggccctgaagagccggggcgtcaacgcgatcgtcctc
agcatgcacgacggcgcggtcgccggcagcaacttcgagagcggcaccaacccctccggc
ccggcctacgaactggccctgcgggtctccccgctcatcgacgccatcgtcaccggccac
tggcactgcgccttcaccatgatgctgcccgaccccaagggcgtgccccgcccgttcgtc
gaggccggctgctacggccagatcatcaacgagatcaacctgcggctggacccggtgagc
gggaaggcgatccgggagctgaccacctccgtcaaccaccccaacacccgcgacgtgacg
ccggatccggagctgaagtcgatcgccgactactgggcgggctacggcgcccgccgcgcc
cgcacccggatcggcacccagaccgcctccttcacccgacgccgcaacgcggtcggggag
tccaccatgggcaacctcgtcgccgactgggcgctgtgggcgggcggccagccgcacggc
ccgctggacgaccgcggcggccaccgcaacgtccccgccgaactcgccgtcatcgccctg
gccccgcgggtcggtgccgcgatcatcggcggcgacctggtgcgcgacgaggcgtcggac
ggcgtggtcaccttcgggcaggcgtggaacgcggtcggcttcggcgacccgatcatgacc
gtcacggtcaccggccggcagctccacgacgccctggaacagcagtgggcgtccaccgcc
ggcgagggcctgtccttctccccgctcgccgtctccgggaacgtccgctacaccttcgac
gccgccggccgggccgggcaccggatcgaccccgcggacgtccgcatcgacggcaagccg
ctggacctcacccgccgctaccgcctcgccgccccctcgtacaccctcatcaaccaggac
ggcttcagcgccttcaccggcttcaccgatccggtccggcacacccgggacttcgagagc
ttcatcgcctacgtccgctcccggcgccggctctccccgtccgagctgaaccgcatcacg
gtcaagaacgcccacctcgccggcgcccgggtcggttccgtcgccgagcaccagcagctc
ctccaggccgacggggaccgcatcccgcgccccgaggaggcgctgcgcaaggcgctcgcc
ggcgacgccgagggccagcgcgcgcccggcggcttccgggtcccctgctga

DBGET integrated database retrieval system