KEGG   Streptomyces albulus NK660: DC74_6322Help
Entry
DC74_6322         CDS       T03082                                 

Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00562  Inositol phosphate metabolism
salu00564  Glycerophospholipid metabolism
salu01100  Metabolic pathways
salu01110  Biosynthesis of secondary metabolites
salu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:salu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DC74_6322
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DC74_6322
   00565 Ether lipid metabolism
    DC74_6322
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DC74_6322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:salu02042]
    DC74_6322
Enzymes [BR:salu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     DC74_6322
Bacterial toxins [BR:salu02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   DC74_6322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIA06759
UniProt: A0A059W5J0
Position
7223461..7225518
Genome map
AA seq 685 aa AA seqDB search
MADINRRRFLQIAGATAGVTALSGSIARAAAIPARRSTGSIKDIEHIVVLMQENRSFDHY
FGSLKGVRGFGDPRPVTQPSGKSVWYQANGGKDVLPYHPDAENLGMQFIEGLNHDWHGGH
QAWNNGKYDQWIPAKGTGTMAYLTRKDIPFHYALADAFTVCDAYHCSLMGATDPNRYYMW
TGYVGNDGTGGGPVVGNEEAGYGWTTYPERLEKAGVSWKIYQDIGDGLDAAGKWGWIDDA
YRGTYGDNSLLFFNQYRNAKPGDPLYDKARTGTNVKQGDGYFDQLKADVKAGKLPQVSWI
AAPEAFSEHPNWPANYGAWYVSQVLDALTSNPDVWSKTALFITYDENDGYFDHVVPPFPP
ASAAQGLSTVDTALDHYPGSAGYAAGPYGLGQRVPMLVVSPWSTGGYVCSEVFDHTSIIR
FMENRFGVHEPHITPWRRAVCGDLTSAFDFSLENTKPAALPDTKGYQPPDHNRHDSYHPT
PPANPVLPTQETGSRPSRPLAYVPLTDGAADVAGGRFTLTFSGGNAAGACFLVTAPNRTD
GPWTYTTEAGKTLSDTWNTTYSKGAYDLTVHGPNGFLRTFKGPGKKQTPEVTARHDAASG
QVALTLTNPGTVACNLTIANAYGGAKQTVRVDPGGTVTRPVDLTASKRWYDLTVTADTDA
GFLRRFAGHVETGKPGVSDPALRTG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcaaccgccggcgtttcctccagatagccggcgccaccgcgggcgtcacc
gccctctccggcagcatcgcccgcgccgccgccatcccggcccggcgcagcaccggctcc
atcaaggacatcgagcacatcgtcgtcctcatgcaggagaaccgctccttcgaccactac
ttcggttcgctgaagggcgtccgcggtttcggcgacccgcgcccggtcacccagccgagc
ggcaagtccgtctggtaccaggcgaacggcggcaaggacgtgctgccctaccaccccgac
gccgagaacctcggcatgcagttcatcgagggcctcaaccacgactggcacggcggccac
caggcgtggaacaacggcaagtacgaccagtggatccccgccaagggcaccggcaccatg
gcgtacctgacccgcaaggacatcccgttccactacgcgctcgccgacgcgttcaccgtc
tgcgacgcgtaccactgctcgctgatgggcgccaccgaccccaaccgctactacatgtgg
accggttacgtcggcaacgacggcaccggcggcggcccggtcgtcggcaacgaggaggcc
ggctacggctggaccacctaccccgagcgcctggagaaggccggcgtctcctggaagatc
taccaggacatcggcgacggcctggacgccgccggcaagtggggctggatcgacgacgcc
taccgcggcacctacggcgacaactccctgctcttcttcaaccagtaccgcaacgccaag
cccggcgacccgctctacgacaaggcccgtaccggcaccaacgtcaagcagggcgacggc
tacttcgaccagctcaaggccgacgtcaaggccggcaaactgccgcaggtctcctggatc
gccgcccccgaagccttctccgagcaccccaactggccggccaactacggcgcctggtac
gtctcgcaggtcctggacgcgctcacctccaacccggacgtgtggagcaagaccgccctg
ttcatcacctacgacgagaacgacggctacttcgaccacgtcgtcccgccgttcccgccg
gcctccgccgcccagggcctgtccaccgtggacaccgccctggaccactaccccggcagc
gccggctacgccgccggcccctacggcctcggccagcgcgtcccgatgctggtggtctcg
ccctggagcaccggcggctacgtctgctccgaggtcttcgaccacacctccatcatccgg
ttcatggagaaccgcttcggcgtccacgagccccacatcacgccctggcgccgagccgtc
tgcggcgacctcacctccgccttcgacttctcgctggagaacaccaagccggcggcgctc
ccggacaccaagggctaccagccgccggaccacaaccggcacgacagctaccaccccacg
ccgcccgccaaccccgtcctgcccacgcaggagaccggctcccggcccagccgcccgctg
gcctacgtgccgctgaccgacggcgccgcggacgtcgccggcggccgcttcaccctcacc
ttcagcggcggcaacgccgccggcgcctgcttcctggtcaccgcgcccaaccgcaccgac
ggcccctggacgtacacaaccgaggccggcaagaccctctccgacacctggaacaccacc
tactccaagggcgcctacgacctgacggtgcacggacccaacggcttcctgcgcaccttc
aagggccccggcaagaagcagacccccgaggtcaccgcccgccacgacgcggcctccgga
caggtcgcgctgaccctgaccaacccgggcaccgtggcctgcaacctgaccatcgccaac
gcctacggcggcgccaagcagaccgtccgggtggacccgggcggcaccgtcacccgtccc
gtcgacctcaccgcgagcaagcgctggtacgacctgacggtcaccgccgacaccgacgcc
ggcttcctgcgccggttcgccggccacgtcgagaccggcaagccgggcgtcagcgacccg
gcgctccgcaccggctga

DBGET integrated database retrieval system