KEGG   Streptomyces albulus NK660: DC74_7363Help
Entry
DC74_7363         CDS       T03082                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
salu  Streptomyces albulus NK660
Brite
KEGG Orthology (KO) [BR:salu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DC74_7363
Enzymes [BR:salu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     DC74_7363
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     DC74_7363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Pilosulin
Motif
Other DBs
NCBI-ProteinID: AIA07785
UniProt: A0A059WDF3
Position
8343765..8344847
Genome map
AA seq 360 aa AA seqDB search
MTDTTETAETTRSGRPPAGQLPLLAVTLGDPAGIGPEITARTLADPASAALGRGLAVGDA
AVLRRAVELCGLDVRVNPVGGPGEARFAPGTIDVWDLDVAPGDLPWGRVNAVAGRSAVAA
VEAATRAALAGEVDAVVTSPINKEAIWAAGSRHLGHTEMLGELTGADRVDTMFVVRGLKI
FFTTRHLALRKALDQLTEDRVAASIRHAVTALRVFGHEAPRLAVAAVNPHGGEGGHFGDE
EITVLGPAVAGAVADGLDVTGPVPADAVFHQGLEGRFDGVLSHFHDQGHIPAKTVDFAGT
VSVTVGLPILRTSVDHGTAFDLAGSGRASHATMAAAFRAAADFSRCTDRIRAAYGTAVAR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacggacacgacggagacagcggagacgacgagatccgggcggccgcccgccggacaa
ctcccgctgctggccgtgacgttgggcgatccggccggcatcggaccggagatcaccgcc
cgcaccctcgccgacccggcgagcgcggcgctcggccgcgggctggccgtcggcgacgcc
gccgtgctgcgccgcgccgtggaactctgcggactcgacgtccgggtgaacccggtgggc
gggcccggcgaggcgcggttcgcccccggcaccatcgatgtctgggacctcgacgtcgcc
cccggtgacctgccctgggggcgggtgaacgcggtcgccggccgctcggcggtggcggcg
gtcgaggcggccacccgggccgcgctggccggcgaggtcgacgccgtcgtcacctcgccg
atcaacaaggaggcgatctgggcggcgggttcccggcacctggggcacaccgagatgctc
ggcgagctgaccggggcggaccgcgtggacaccatgttcgtggtgcgcggcctgaagatc
ttcttcaccacccggcacctcgcgctccgcaaggccctggaccagctcaccgaggaccgg
gtcgccgcgagcatccgccacgcggtcaccgcactgcgggtcttcggccacgaggcgcca
cggctcgcggtcgccgcggtcaacccgcacggcggcgagggcggccacttcggcgacgag
gagatcaccgtgctgggccccgcggtggccggtgcggtggccgacggactggacgtgacc
gggccggtgcccgccgacgcggtcttccaccaggggctcgaaggccgcttcgacggcgtg
ctctcgcacttccacgaccagggccacatccccgccaagacggtcgacttcgccggtacg
gtctcggtcaccgtcggcctgccgatcctgcggacctccgtcgaccacggcaccgccttc
gacctcgccggcagcgggcgcgcctcgcacgccaccatggccgccgccttccgtgccgcc
gccgacttcagccgttgcacggaccggatccgcgccgcctacgggacggcagtggcccga
tga

DBGET integrated database retrieval system