KEGG   Snodgrassella alvi: SALWKB2_0142Help
Entry
SALWKB2_0142      CDS       T03063                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
salv  Snodgrassella alvi
Pathway
salv00670  One carbon pool by folate
salv01100  Metabolic pathways
salv01120  Microbial metabolism in diverse environments
salv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SALWKB2_0142
Enzymes [BR:salv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SALWKB2_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AHN27524
UniProt: X2H2B4
Position
complement(181884..182717)
Genome map
AA seq 277 aa AA seqDB search
MSFTQLSFEFFPPRTEEGRRKLAITRKQLSQYQPEYFSCTYGAGGTTRAGTLQTITDIMN
DGVAAAPHLACIGASREEMISLLQTYKDMGIRHIVALRGDVPSGVGFGHQGLRYANELVA
LIRQEFGDWFHIEIAAYPEFHPQSRSAEDDINHFVRKCQAGADSAITQYFFNADSYFWFV
DEVQGRGIDIPIIPGIMPIASFSKLARFSETCGAEIPRWLRLKLQSYADDTASIKALGLD
VVTEMCDHLLQQGAPSLHFYTLNQAGLVSTICQRLGY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagttttacccagttgagctttgaattttttccgccgcgtactgaagagggacggcgc
aaactggccatcacccgcaaacagttaagccaatatcaacctgaatatttttcatgtact
tatggtgcaggtggaactacacgagccggtacattgcaaacaattaccgatattatgaat
gatggagtagcagccgctccccatctggcctgtattggcgccagccgtgaagaaatgatc
agcctgctccaaacctacaaagacatgggcatccgtcatattgtagccttacgtggtgac
gttccgtcaggcgtgggctttggacatcagggactgcgctacgcaaatgagctggttgct
cttatccgccaggagtttggtgactggtttcatattgaaattgctgcctatccggagttt
caccctcaatcacgcagtgctgaagacgatatcaatcattttgtacgtaaatgtcaggcc
ggcgccgattccgcaattacccaatattttttcaatgcagacagttatttctggtttgta
gacgaagtacaaggcagaggaatagatattcccattatccccggcatcatgcctattgcc
agcttttccaaattggcacgcttttcagaaacctgtggcgcagagattccgcgctggtta
cgcctaaaacttcagtcttatgcagatgatacagcatcaattaaagcacttgggctggat
gtagtaactgaaatgtgcgaccatttgcttcagcagggagcacccagcctgcatttttat
actctgaatcaggccggacttgtatcgactatatgtcagcgattaggttactaa

DBGET integrated database retrieval system