KEGG   Snodgrassella alvi: SALWKB2_1223Help
Entry
SALWKB2_1223      CDS       T03063                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
salv  Snodgrassella alvi
Pathway
salv00230  Purine metabolism
salv00240  Pyrimidine metabolism
salv01100  Metabolic pathways
salv01110  Biosynthesis of secondary metabolites
salv01130  Biosynthesis of antibiotics
Module
salv_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
salv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
salv_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
salv_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SALWKB2_1223
   00240 Pyrimidine metabolism
    SALWKB2_1223
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salv04131]
    SALWKB2_1223
Enzymes [BR:salv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SALWKB2_1223
Membrane trafficking [BR:salv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SALWKB2_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AHN28605
UniProt: X2H8B5
Position
complement(1346567..1346992)
Genome map
AA seq 141 aa AA seqDB search
MTIERTLSIVKPDAVAKNVIGQIYSRFENNGLKIVAAKMKHLSQAEAEGFYAVHKERPFF
ADLVSFMISGPVMIQVLEGENAVAKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSD
SLENAAIEIAYFFAADELCAR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgagcgcacattatctattgttaaacctgatgcagttgctaaaaacgttatc
ggacagatttacagccgttttgaaaataacgggctgaaaattgttgctgctaaaatgaaa
catttgtctcaagctgaggctgaaggtttttatgctgttcataaggaacgtccgtttttt
gcagatctggtaagttttatgattagcggaccagtgatgattcaggtgctggaaggtgaa
aatgcagtcgccaaaaatcgagaattaatgggtgcaactaaccctaaagaagccgctgca
ggcacaattcgtgctgatttcgctgattcaattgatgccaatgctgttcatggctcagac
agccttgaaaatgcagctattgaaattgcatatttttttgcagccgatgagctatgtgct
cgttaa

DBGET integrated database retrieval system