KEGG   Snodgrassella alvi: SALWKB2_1752Help
Entry
SALWKB2_1752      CDS       T03063                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
salv  Snodgrassella alvi
Pathway
salv00071  Fatty acid degradation
salv00280  Valine, leucine and isoleucine degradation
salv00310  Lysine degradation
salv00362  Benzoate degradation
salv00380  Tryptophan metabolism
salv00620  Pyruvate metabolism
salv00630  Glyoxylate and dicarboxylate metabolism
salv00640  Propanoate metabolism
salv00650  Butanoate metabolism
salv00900  Terpenoid backbone biosynthesis
salv01100  Metabolic pathways
salv01110  Biosynthesis of secondary metabolites
salv01120  Microbial metabolism in diverse environments
salv01130  Biosynthesis of antibiotics
salv01200  Carbon metabolism
salv01212  Fatty acid metabolism
salv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SALWKB2_1752
   00630 Glyoxylate and dicarboxylate metabolism
    SALWKB2_1752
   00640 Propanoate metabolism
    SALWKB2_1752
   00650 Butanoate metabolism
    SALWKB2_1752
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SALWKB2_1752
   00072 Synthesis and degradation of ketone bodies
    SALWKB2_1752
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SALWKB2_1752
   00310 Lysine degradation
    SALWKB2_1752
   00380 Tryptophan metabolism
    SALWKB2_1752
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SALWKB2_1752
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SALWKB2_1752
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SALWKB2_1752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salv04147]
    SALWKB2_1752
Enzymes [BR:salv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SALWKB2_1752
Exosome [BR:salv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SALWKB2_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN29134
UniProt: X2H6Z9
Position
1952800..1953981
Genome map
AA seq 393 aa AA seqDB search
MTKIVIVSAARTAIGSFNGSLASVSAINLGKVVIDEALKRAALDAGAVNEVIMGNVLQAG
LGQNPARQAALNAGIPSSVPAFTVNKVCGSGLKSIVLATQSILTGDNDIVVAGGMENMSQ
APYLLGSKARWGLKMGNAELYDTMVNDGLTCATNHYHMGITAENIAEQYSISREEQDELA
LRSQKLATEANNNGDFEAEIVPVTISSRKGDIIFKQDEYPKADSTAEGLAKLRPAFKKDG
TVTAGNSSGINDGAAALVLMSETKAKELGLKPLAYIRSYASGGVDPSIMGMGPVPATRLA
LQKAALQLSDIDLIEANEAFAAQFLGVGRELNFDMDKTNIHGGAIALGHPIGASGARILV
TLLYSMLHRDKQLGLATLCIGGGQGTAVILERC
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgtaatcgtcagtgctgcacgcaccgccatcggcagttttaatggttca
cttgcctctgtcagtgccattaatttggggaaagttgttattgacgaagctttaaaacgt
gctgcactggatgccggtgcggtaaatgaagtgattatgggtaatgtgcttcaggccgga
ctgggacagaatcctgcccggcaggctgcactgaatgcaggtattcccagcagcgtaccg
gcttttactgtaaataaggtatgcggcagcgggcttaaatcaatcgtactggccacacaa
agtattttaaccggtgacaacgatattgttgtcgccggcggtatggaaaatatgtctcag
gcaccctatctgcttggcagtaaagcccgctgggggctgaaaatgggtaatgccgaattg
tacgataccatggtgaatgacggattaacctgtgctaccaatcattaccatatgggaatt
accgcagaaaatattgctgaacaatattctatcagccgtgaggaacaggacgaactggca
ctgcgttctcaaaagctggctacggaagctaataacaatggtgactttgaagcagaaatt
gttccggtcaccatcagctcacgcaagggcgatattatcttcaaacaggatgaatatccc
aaagcagacagcacggcggaaggtctggcaaaactcagaccggcgtttaaaaaagacggt
acagtgactgcgggtaattcttccggtattaatgacggtgccgctgctcttgtgctgatg
tctgaaaccaaagcaaaagaattaggcttaaaaccactggcatatattcgcagctatgct
tctggcggcgttgatccgagcataatgggaatgggtccggtaccggcaacccggctggct
ttacaaaaagcagcactgcagctgtctgatatcgatttaatcgaagcaaatgaagctttt
gctgctcaattcctcggtgtcggacgcgagctgaattttgacatggacaaaaccaatatt
catggtggtgccattgccctgggtcatcctattggcgccagcggtgcgcgtattctggtt
accctgctttattctatgcttcatcgtgataaacagctgggactggcaacattatgcatt
ggcggcggacaaggtacggctgttattctggaacgctgttaa

DBGET integrated database retrieval system