KEGG   Snodgrassella alvi: SALWKB2_1790Help
Entry
SALWKB2_1790      CDS       T03063                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salv  Snodgrassella alvi
Pathway
salv00450  Selenocompound metabolism
salv00970  Aminoacyl-tRNA biosynthesis
salv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SALWKB2_1790
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SALWKB2_1790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salv01007]
    SALWKB2_1790
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salv03016]
    SALWKB2_1790
Enzymes [BR:salv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SALWKB2_1790
Amino acid related enzymes [BR:salv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SALWKB2_1790
Transfer RNA biogenesis [BR:salv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SALWKB2_1790
 Prokaryotic type
   Other AARSs
    SALWKB2_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 SPATA24 DUF3886
Motif
Other DBs
NCBI-ProteinID: AHN29172
UniProt: X2HDM0
Position
complement(1996563..1998620)
Genome map
AA seq 685 aa AA seqDB search
MTKQRKILVTSALPYANGNIHLGHMVEHIQTDIWVRFQKARGHECYYVCADDTHGTPVML
AAQKQGITPEEMITQVRQNHLADFTGFGIGYDNYYSTHSPENKALSRSIYLALKANGKIE
SRTIEQLFDPEKNLFLPDRFVKGECPKCHAQDQYGDNCEVCGTTYSPTELIKPYSAISGA
TPVLKESEHFFFKLGECADYLKQWTAGSTKLKNGREQPHLQAEALNKMNEWLQNDSLSDW
DISRDAPYFGFEIPDAPGKYFYVWLDAPIGYMASFKNLCERLGIDFDQWFCADTDTEMYH
FIGKDILYFHALFWPATLQYANLRAPTGIFAHGFLTVDGQKMSKSRGTFITAHSYLEQRL
NPEWLRYYFAAKLNSRIEDLDLNLNDFIARVNSDLVGKYINIAARAAGFISKRFQGTLAD
VSNSELLPQLQAQSENIAASFEAREYARALREIMALADVVNEYVDANKPWELARQEGQET
RLQQVCSELINAFRILTVYMSPVLPKLATEAAAFLNVAPLSWADSTTLLPAGHHINAYQH
LMHRVEQKQIDDLIAANQQNIQTVETAAETKYEPVADTASFDDFMKIDMRVAKVLTCEKV
EGSSKLLKFQLDLGFEQRTIFSGIAASYPEPEKLTGRMVIVVANFAPRKMAKFGMSEGMI
TSAAGNGKLFLLDVDSGAEPGMKVG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacgcaaaatactggttacttcagccttgccctatgcaaacggtaatatt
catctgggacatatggttgaacatattcagactgatatctgggtgcgtttccagaaagca
cgcggacatgaatgctattacgtctgtgcagacgatacgcatggtacgccggtcatgctg
gcggcacagaaacagggaataacaccggaagaaatgattactcaggtacgtcagaatcat
ctggctgattttaccggctttggtattggctatgataattattacagtacgcactcacct
gaaaataaagctttatcacgcagcatttatctggctttaaaagccaatggaaaaattgaa
agccgtactattgagcaattatttgatccggaaaaaaatctgtttctgcccgatcgtttt
gttaaaggtgaatgtccgaaatgtcatgcacaggatcagtatggtgataattgtgaagta
tgcggcactacttatagtcctaccgaactgattaaaccgtattctgctatttccggcgcc
actcctgtattgaaagaatctgagcatttcttctttaaactcggagaatgtgcggattat
ctgaaacagtggactgccggcagtaccaagctgaaaaatggtcgcgagcagccgcatttg
caggcagaagccctgaataaaatgaatgaatggttgcagaacgatagcctgagtgattgg
gatatcagtcgtgatgcgccttatttcggctttgaaattccggatgctcccggtaaatat
ttttatgtgtggctggatgcacctatcggctacatggcatcatttaaaaacctttgtgaa
cgtctgggcattgattttgatcagtggttctgtgctgatactgataccgaaatgtatcat
ttcatcggtaaggatattttatattttcatgcattattctggccggctactttgcaatac
gccaatctgcgggcaccaacaggcatatttgcacacggttttctcacggtagacggacag
aaaatgtccaaatcacgcggtacttttatcacagcccattcctatcttgagcagcgactg
aatcccgaatggctgcgttattattttgcagccaaactcaatagcagaattgaagatctg
gatttaaatctgaatgattttatcgcccgggttaatagtgatttggttggtaaatacata
aatatcgccgcacgtgctgccggattcatcagcaaacgctttcagggaacactggctgat
gttagcaacagcgagctgttaccacagctacaggcgcaaagtgaaaatattgctgccagc
tttgaagcacgtgagtatgcgcgtgccttacgtgaaatcatggcattagctgatgtggtg
aatgagtatgtcgatgccaacaaaccatgggagctggcgcgacaggaaggacaggagaca
cgtttacagcaagtatgcagtgaactgattaatgctttccgtattctgaccgtatatatg
tcaccagtattgcctaagcttgctacagaagcagccgcttttctgaatgtggcgccatta
agctgggctgatagtacaaccttattacctgccggtcatcacatcaatgcatatcagcat
ctgatgcaccgggtggaacagaaacagattgatgacctgattgccgcgaatcagcagaat
attcagacagttgagactgctgctgaaacaaagtatgagcctgtggcagatacggcttca
tttgatgactttatgaaaatcgatatgcgtgttgccaaagtgttgacatgcgaaaaagtc
gaaggcagtagcaaactgctcaaatttcagcttgatcttggttttgagcagcgcacaata
ttctctggtattgccgccagctatcctgaaccggaaaaactgactggaagaatggtcatt
gtggtagccaattttgcgccgcgtaaaatggcaaaatttggcatgtctgaagggatgatt
acttcagcagccggtaatggcaaactgtttttactggatgtggatagtggggctgaaccg
ggtatgaaggtcggctga

DBGET integrated database retrieval system