KEGG   Salinivibrio sp. YCSC6: E8E00_00975Help
Entry
E8E00_00975       CDS       T05946                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
saly  Salinivibrio sp. YCSC6
Pathway
saly00564  Glycerophospholipid metabolism
saly01100  Metabolic pathways
saly01110  Biosynthesis of secondary metabolites
Module
saly_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:saly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    E8E00_00975 (psd)
Enzymes [BR:saly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     E8E00_00975 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Phage_base_V
Motif
Other DBs
NCBI-ProteinID: QCF34867
Position
I:complement(215573..216436)
Genome map
AA seq 287 aa AA seqDB search
MRDDLKVGLQYIAPKHALTRMMGKLASLKGGWFTTAVIKWFIKQYQVDMSEAKVSDPAYY
RTFNDFFVRELKPALRPIDGDAETLVYPADACVSQAGLIEQGRIIQAKGHSFDVTELVGG
DHALADQFKEGHFATLYLSPRDYHRVHMPCDAVLREMVYIPGDLFSVNPLTAENVPNLFA
RNERVVCVFETEFGPMVQVLVGATIVGSIATTWAGTVTPPTGGSIRRWEYPTEGEQAIRF
AQGDEMGLFKLGSTVINLFPAGAIRFHDDVAPGTPTQMGQPYAHRQA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagacgatttgaaagtcggcctgcaatatatagcgccgaaacatgcccttacccga
atgatggggaaactagccagccttaaaggtggatggtttaccactgctgtgatcaaatgg
tttatcaagcaatatcaggtcgatatgagtgaggccaaagtcagtgaccctgcctactat
cgcacctttaacgactttttcgtgcgagagctcaagcccgcgttacgccccattgatggc
gatgcagagacgttggtctatcccgccgatgcgtgcgtcagtcaagccggattgattgag
caaggacgtattatccaagccaaaggccactcgtttgatgtcactgaactcgtcggtggc
gatcacgcccttgccgaccagtttaaagagggtcactttgccaccctttacttgtcaccg
cgtgactatcaccgtgtgcacatgccatgtgatgccgtgttacgtgaaatggtctacatc
cccggcgatttgttttccgtcaatccactaacggcagagaacgtgccgaacttgtttgcc
cgtaacgagcgtgtagtgtgcgtatttgagactgaatttggacctatggtgcaagttttg
gtgggcgcaaccattgtaggcagtattgccaccacatgggcgggtacagtcactccgcca
accggtggcagcattcgccgatgggaatacccgacagaaggcgaacaagctatccgcttt
gctcagggtgatgaaatgggtctatttaaactcggctcaaccgtgattaacctgttccca
gcaggagcaatccgttttcacgatgacgtagcccccggcaccccaacacaaatgggacag
ccttacgcgcaccgtcaggcataa

DBGET integrated database retrieval system