KEGG   Salinivibrio sp. YCSC6: E8E00_01395Help
Entry
E8E00_01395       CDS       T05946                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
saly  Salinivibrio sp. YCSC6
Brite
KEGG Orthology (KO) [BR:saly00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    E8E00_01395 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB DUF4354 DUF5643
Motif
Other DBs
NCBI-ProteinID: QCF34942
Position
I:complement(305698..306081)
Genome map
AA seq 127 aa AA seqDB search
MQATDNPQFEINIATQYVEDQSEPDNERFVFSYTVTIKNQGDAPAQLMRRKWLITDANGK
ELEIEGEGVVGEQPSIAAGEKYTYTSGTIIETPVGVMQGFYTMQDQADNQFKVEIEPFRL
ALPNILH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagccaccgataacccgcaattcgagattaatatcgcgacccaatacgtcgaagat
caatccgagccggacaacgagcgctttgtgttttcttacaccgtcaccattaaaaaccaa
ggtgatgcgcccgcacagttgatgcgacgcaagtggttaatcacagatgccaacggtaaa
gagctcgagattgagggcgaaggggtggtgggagagcaacccagtattgccgcgggagaa
aagtatacctataccagtggcaccatcattgaaacgcctgtgggcgtgatgcagggtttc
tataccatgcaagatcaagccgataaccagtttaaagtggaaattgagccgttccgcctc
gcgctccctaacattcttcactaa

DBGET integrated database retrieval system