KEGG   Salinivibrio sp. YCSC6: E8E00_05035Help
Entry
E8E00_05035       CDS       T05946                                 

Gene name
ltaE
Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
saly  Salinivibrio sp. YCSC6
Pathway
saly00260  Glycine, serine and threonine metabolism
saly01100  Metabolic pathways
saly01110  Biosynthesis of secondary metabolites
saly01120  Microbial metabolism in diverse environments
saly01130  Biosynthesis of antibiotics
saly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E8E00_05035 (ltaE)
Enzymes [BR:saly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     E8E00_05035 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: QCF35587
Position
I:complement(1112655..1113665)
Genome map
AA seq 336 aa AA seqDB search
MIDFRSDTVTKPDQAMRDAMANAPVGDDVYGDDPSVNALERWAAERHGFDAALFTTSGTQ
ANLLALMSHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENAPDGTLPFEKLAAAI
KPNDFHFARTKLLSLENTIGGRVLPLSYLAEARMFCNKHQLSLHLDGARVYNAAVALDVD
ITAISCHFDSMTVCLSKGLGAPVGSLLLGSKAFIEKARRLRKMLGGGMRQAGILAVAGQK
ALEENVERLAEDHANAHYLANKINEIEGFSTHNYEVQTNIVYVDIADNIDRVRLNMRLMD
NGFRVSLNGAPARFVTHKDVNRQDIDALINAMKKSL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttcgctctgataccgtcaccaaacccgaccaagccatgcgagacgcgatg
gccaatgcccccgtcggcgatgatgtctatggtgatgacccgagtgtcaatgccttagag
cgctgggccgcagagcgtcatggctttgatgccgccctctttaccacatcgggaacgcaa
gccaacctattagcgctaatgtcgcactgtgagcgcggtgacgaatatctgtgtggtcag
caagcgcataactacaaatatgaagccggtggtgcagccgtattaggctctattcagcct
caacccattgaaaatgccccagacggtacgttgccatttgagaagcttgccgcagccatt
aaacctaatgactttcattttgcacgcaccaaattgctcagtttagaaaacaccatcggc
ggccgtgttctacccctttcctacttggccgaagcccgcatgttttgcaacaagcatcag
ctaagccttcaccttgatggcgcacgtgtttacaacgcggcggtggcactggatgtcgat
attaccgcgataagctgccatttcgattcgatgactgtttgcttgtcaaaaggattaggc
gcaccggttggctctttgctattgggctcgaaagccttcattgaaaaagctagacggcta
cgaaaaatgctgggcggaggtatgcgtcaagccggtattctcgccgttgccggacaaaaa
gcactcgaagaaaatgtcgaacgtctcgctgaagatcatgctaatgcccattacttagcc
aataaaatcaatgagattgaaggcttttctacccacaattatgaggtgcaaaccaacatt
gtgtatgtcgatattgccgacaacatcgatcgggttcgtctcaatatgcgcctgatggat
aacggctttcgagtgagtttaaatggcgcaccggctcgctttgtcacccacaaagacgtc
aatcgccaagatatcgacgcattgataaacgcgatgaaaaaatcgctctaa

DBGET integrated database retrieval system