KEGG   Salinivibrio sp. YCSC6: E8E00_10335Help
Entry
E8E00_10335       CDS       T05946                                 

Gene name
rlmM
Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
saly  Salinivibrio sp. YCSC6
Brite
KEGG Orthology (KO) [BR:saly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:saly03009]
    E8E00_10335 (rlmM)
Enzymes [BR:saly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     E8E00_10335 (rlmM)
Ribosome biogenesis [BR:saly03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    E8E00_10335 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: QCF36524
Position
I:complement(2235965..2237053)
Genome map
AA seq 362 aa AA seqDB search
MNQVLLYCRAGFEKDCAAEIQQKTTEMGIYGFPRVINNSAYVLFECYQDGEAEQIVRDLP
LDSLIFARQMIAVTASLSDLDPDDRISPILAVADALPKAGDLRVETPDNDEAKALLKFCR
KFTVPLRQALRKQGVMLAKDNPKKPVIHLCFIAPGTCFVGYSLTTNNSPHYMGIPRMKFP
ADAPSRSTLKLEEAFHHFIPKEEWDTRLAPGLWAVDLGACPGGWTYQLVKRSMFVHAVDN
GAMDESLMETGQVFHHAEDGFKFEPSRKNVTWLVCDMIEKPSRVAQLMGEWLIAGWAKEA
MFNLKLPMSRRYEQVSYNLDTLGEFLKQHNIPYEMKAKHLYHDREEITVYLRRVKRQHSL
NG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggttttgctttactgtcgtgcagggtttgaaaaagactgtgcggcggaaatt
caacaaaaaaccactgagatgggtatttacggatttccgcgagtgattaacaacagcgcc
tatgtgctgtttgaatgctaccaagacggtgaggctgagcagattgtccgtgatctgccg
ctcgattccctgatctttgcccggcaaatgattgcggtgaccgcatcgctctctgatctg
gatccggacgaccgaatttccccgattttggctgttgcggatgcactgcctaaagcggga
gacttacgggtggagacgccggataatgacgaggcgaaagccttattgaagttttgtcgt
aagttcaccgttccattgcgtcaggcactgcgaaagcagggcgtgatgttagcaaaagac
aatcctaaaaagccggttattcatctttgctttatcgcgccggggacatgctttgtgggt
tactcattgaccaccaataactcaccgcattacatgggcatcccgcgcatgaaatttcct
gccgatgcgccgagtcgctcgaccttaaagttagaagaggcgttccatcactttattcct
aaagaagagtgggatacgcgactcgcgcccggattatgggcggtcgacttgggggcttgt
cccggcgggtggacttaccagttagtgaagcgttcgatgtttgtgcatgcggttgataac
ggcgcgatggatgaaagcttgatggaaactggtcaagtattccatcatgccgaagatggc
tttaagtttgagccctcgagaaaaaatgtgacttggttggtctgtgacatgatcgaaaaa
ccttcccgcgtcgctcaactcatgggggagtggttgattgcagggtgggcgaaagaggcc
atgttcaacttgaagcttcccatgagccgtcgatatgagcaggtttcttataacctcgac
accttgggtgagtttttaaagcagcacaacattccctacgagatgaaggcgaaacacctt
tatcacgatcgtgaagaaatcaccgtgtacttgcgtcgtgtaaaacgtcaacactcgttg
aatggttag

DBGET integrated database retrieval system