KEGG   Salmonella sp. SSDFZ69: EOS98_20505Help
Entry
EOS98_20505       CDS       T06160                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
salz  Salmonella sp. SSDFZ69
Pathway
salz00564  Glycerophospholipid metabolism
salz01100  Metabolic pathways
salz01110  Biosynthesis of secondary metabolites
Module
salz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:salz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EOS98_20505 (psd)
Enzymes [BR:salz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EOS98_20505 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: AZY99803
Position
4128884..4129852
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMTEAQKPDTASY
RTFNDFFVRPLRDDVRPLNTDPNILVMPADGVISQLGRIEEDKILQAKGHNYSLEALLAG
NYLMADKFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPEGEHEGSVA
LLKGQEMGRFKLGSTVINLFAPGKVNLIESLASLSVTKIGQPLATSTETFVAPEVEPAPL
PAEEIKAEHDASPLVDNKKDDT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaaactttcgctacaatacattctgccgaaactatggctcactcgc
ctggcgggctggggcgcaagcaaacgagcaggatggctgacaaaactggttatcgatctc
ttcgtaaagtattacaaagtcgatatgaccgaggcgcaaaaaccggataccgccagctat
cgtacgttcaatgatttctttgttcgtccgctgcgtgatgacgtgcgtccgctcaatacc
gatcctaacatcctggtgatgcctgctgacggcgtgataagccagttgggtcgtatcgaa
gaagataaaattttgcaggccaaaggccataattacagccttgaggcgttgctggcgggt
aactacctgatggcggataagttccgcaacggcacgtttgtgaccacttacctctcccct
cgcgactaccatcgcgtgcacatgccatgcaacggcatcctgcgtgaaatgatctacgta
ccgggcgatctgttctccgttaaccatctgaccgcgcaaaacgtccccaacctgtttgcc
cgcaacgagcgcgttatctgcctgtttgataccgagttcggccctatggcgcagattctg
gtcggcgcaactattgtcggcagtatcgaaaccgtctgggcggggaccattaccccgccg
cgcgaaggcatcatcaagcgctggacctggccagaaggcgaacatgaagggtctgtcgcc
ttgttgaaaggccaggagatgggacgctttaaactgggttccacggtcatcaacttattt
gcgccggggaaagtgaatctgatcgagtcgctggcaagcctgtccgttaccaaaattggc
caaccgctggcgacgtcgaccgaaacattcgtcgcgccggaggtagaacctgctccgctg
ccggcagaagaaattaaagccgaacacgacgccagcccgctggttgacaataaaaaagac
gacacctaa

DBGET integrated database retrieval system