KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0201
Entry
MW0201            CDS       T00086                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00620  Pyruvate metabolism
sam00640  Propanoate metabolism
sam00650  Butanoate metabolism
sam01100  Metabolic pathways
sam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MW0201 (pflB)
   00640 Propanoate metabolism
    MW0201 (pflB)
   00650 Butanoate metabolism
    MW0201 (pflB)
Enzymes [BR:sam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     MW0201 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 zf-C2HCIx2C
Other DBs
NCBI-ProteinID: BAB94066
NITE: MW0201
UniProt: Q7A1W9
Position
236897..239146
AA seq 749 aa
MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLAGPTEATSKLWEQVMQ
LSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEKPFKRSMQPFGGIRMAK
AACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKAGVITGLPDAYGRGRIIG
DYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQYRALKELKELGQKYGFDL
SRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLKAGVITESEVQEI
IDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGIDGRPLVTKNSFRFLHSLDNLG
PAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDDIMRESYGDDYGIACCVSAMTI
GKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFEGINSEVLEYDEVFKKFDQMMDW
LAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTMATGIAGLSVAADSLSAIKYAQVK
PIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLVERFMTKLRSHKTYRDSEHTMSVLT
ITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDQKGALSSLSSVAKIPYDCCKDGISN
TFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHHLNINVFNRETLIDAMEHPEEYPQLTI
RVSGYAVNFIKLTREQQLDVISRTFHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgttagaaacaaataaaaatcatgcaacagcttggcaaggatttaaaaatggaagatgg
aacagacacgtagatgtaagagagtttatccaattaaactacactctttatgaaggtaat
gattcatttttagcaggaccaacagaagcaacttctaaactttgggaacaagtaatgcag
ttatcgaaagaagaacgtgaacgtggcggcatgtgggatatggacacgaaagtagcttca
acaatcacatctcatgatgctggttatttagacaaagatttagaaacaattgtaggtgta
caaactgaaaagccattcaaacgttcaatgcaaccattcggtggtattcgtatggcgaaa
gcagcttgtgaagcttacggttacgaattagacgaagaaactgaaaaaatctttacagat
tatcgtaaaacacataaccaaggtgtattcgatgcatattctagagaaatgttgaactgc
cgtaaagcaggtgtaatcactggtttacctgatgcatacggacgtggacgtattatcggt
gactatcgtcgtgtagctttatatggtgtagatttcttaatggaagaaaaaatgcacgac
ttcaacacgatgtctacagaaatgtcagaagatgtaattcgtttacgtgaagaattatca
gaacaatatcgtgcattaaaagaattaaaagaacttggacaaaaatatggtttcgattta
agccgtccagcagaaaacttcaaagaagcagttcaatggttatacttagcataccttgct
gcaattaaagaacaaaacggtgcagcaatgagtttaggtcgtacatcaacattcttagat
atctatgctgaacgtgaccttaaagcaggcgttattactgaaagcgaagttcaagaaatt
attgaccacttcatcatgaaattacgtattgttaaatttgctcgtacacctgattacaat
gaattattctctggagacccaacttgggtaactgaatctatcggtggtgtaggtattgac
ggacgtccacttgttacgaaaaactcattccgtttcttacactcattagataacttaggt
ccagctccagaaccaaacttaacagtattatggtcagtacgtttacctgacaacttcaaa
acatactgtgcaaaaatgagtattaaaacaagttctatccaatatgaaaatgatgacatt
atgcgtgaaagctatggcgatgactatggtatcgcatgttgtgtatcagcgatgacaatt
ggtaaacaaatgcaattcttcggtgcacgtgcgaacttagctaaaacattactttacgct
atcaatggtggtaaagatgaaaaatctggtgcacaagttggtccaaacttcgaaggtatt
aacagcgaagtattagaatatgacgaagtattcaagaaatttgatcaaatgatggattgg
ctagcaggtgtttacattaactcattaaatgttattcactacatgcacgataaatacagc
tatgaacgtattgaaatggcattacatgatacagaaattgtacgtacaatggcaacaggt
atcgctggtttatcagtagcagctgactcattatctgcaattaaatatgcacaagttaaa
ccaattcgtaacgaagaaggtcttgtagtagactttgaaatcgaaggcgacttccctaaa
tacggtaacaatgacgaccgtgtagatgatatcgcagttgatttagtagaacgctttatg
actaaattacgtagtcataaaacatatcgtgattcagaacatacaatgagtgtattaaca
attacttcaaacgttgtatacggtaagaaaactggtaacacaccagacggacgtaaagct
ggcgaaccatttgcaccaggtgcaaacccaatgcatggccgtgaccaaaaaggtgcatta
tcttcattaagttctgtagctaagatcccttacgattgctgtaaagatggtatttcaaat
acattcagtatcgtaccaaaatcattaggtaaagaaccagaagatcaaaaccgtaactta
actagtatgttagatggttacgcaatgcaatgtggtcaccacttaaatattaacgtattt
aaccgtgaaacattaatagatgcaatggaacatccagaagaatatccacagttaacaatc
cgtgtatctggttacgctgttaacttcattaaattaacacgtgaacaacaattagatgta
atttctcgtacattccatgaaagtatgtaa

DBGET integrated database retrieval system