KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0597
Entry
MW0597            CDS       T00086                                 

Definition
(GenBank) hypothetical protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Motif
Pfam: Peptidase_M50B Otopetrin Peptidase_M50
Other DBs
NCBI-ProteinID: BAB94462
NITE: MW0597
UniProt: A0A0H3JZ38
Position
complement(679438..680190)
AA seq 250 aa
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaattatttatcaaacttttttaatacgacaattcaacttaatatatacattatcgtt
attgttgcagcttgttatattgctattcatcaatatagacataagcctgttttgaactat
ttagatgtcattttaaactatatccctgttttaacacatgaatttggtcatgtactgttt
aataaactcgctggtggccgtgcaaaagatttagtcattgtaacaagtccacgagagcga
caacagacattacaacaaggattcgcaattacacaatctagacatctagcaggccaatgg
cttacaacgattggtggttatttaatgccacctattatgttattgataggtttagcgtcg
agccattatcagatacctagtttctttatatttacctatttattgatatttatttatttt
ttaattttaacatctagaaaaggctcacccattgttgttataactttaatttctatcatg
ttgtattttatattaaaagatgaaaatatagtagaaattcaactacttgtcacaatgagt
tatcaatatattttaggtgtattattaggcgaagttctacaatctagttggacgattgct
aaattgactttccagcgtccgagtccacagtgggatggtagtgcacttaaagaactcagt
catgtacctatcttcatttatagtacaatctggattatcttcaatctttatgcagtgaat
attttactcaaatatactcacttgataaattaa

DBGET integrated database retrieval system