KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0926
Entry
MW0926            CDS       T00086                                 
Name
(GenBank) ORFID:MW0926; hypothetical protein, similar to menaquinone-specific isochorismate synthase
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00130  Ubiquinone and other terpenoid-quinone biosynthesis
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MW0926
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    MW0926
Enzymes [BR:sam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     MW0926
SSDB
Motif
Pfam: Chorismate_bind vATP-synt_E
Other DBs
NCBI-ProteinID: BAB94791
NITE: MW0926
UniProt: A0A0H3JVV5
Position
1016897..1018258
AA seq 453 aa
MATGVLEDDIVKEIYGSSKEWVSVEVKLSQSLDPSTLFHLTDNEAGDRFYMRLNDNRTSY
FGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQFSSHKSDDEWR
EFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDIDVDEQIGEIT
RNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQAYSKEKNSYIF
LLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAFLKDNKNLIEH
RFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYISLIDNLHPTPA
LGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKKAQATLFAGCG
IVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggctacgggcgtattagaggacgatattgtcaaagagatatatggcagctcaaaggaa
tgggtttcagttgaagtgaaattatcacagtcactagacccgagcacattatttcatctc
actgacaatgaggcaggagatcgcttttatatgcgtttgaatgataatcgaacgtcatat
tttggctacaaagcaattcaattattcaaaaataattctaaaaataaacaatctattttt
aaagactgggaaaaattaaaacataacatcacatttatacatccgcaatctgagaaacat
catcttcgagttgttggaggattccaattttcgagtcataaatcagatgatgaatggcga
gagtttggactaaatcattttgtattacctgaagttttaatttcaactgataataatggg
acatttttaacttatacagttaaaagggaaagttttactgttgaggcattgaacgattta
atggatttgttcaacaatatatcggacatagatgtggacgagcaaattggggaaattact
agaaatgaagatatttataaagatgactggcgtcaacttgtagtagaagctatagaatct
attaataatgaagaaaaaattgtactagcacgtagacggttaataaagttcgataaagat
atcagtattccatatattctaaagcaagcatattctaaagaaaaaaacagttatatattc
ttgttagaatcacaagattctatattcttttcacaaacacctgaacaattaataaaggtc
aataataaaatactatcgactaaagctgtagcaggtacaattaaacgttcacaagatgag
gacgaagatacaaaaaatgttgaagcatttttaaaagataataaaaacttaatcgaacat
cgatttgttgttgacagtattttacatgatattaaaccttatatcactgaattacattat
gataagacgcctaaaattctaaaaaatgatcatttatatcacttgtacactgaaataaag
gcgccactgaaggatgattcgtatattagtttaattgataatttacatccaacacctgct
ttaggtggctatccaaaagaatttgcgatggattttattgaacagaaagaatttggtaca
cgaggattatatggtgcgccggttggctatatagatatatatgatgattgtgaatttatt
gttgcaattcgttcgatgcttattaagaaagcacaagcaactttatttgctgggtgtggc
attgttaaagattctgatccagatagtgaattggcagaaacgaaccttaagttcacacct
atgatgaatgcattaggagtcgatatgaatgggaaatcataa

DBGET integrated database retrieval system