KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0934
Entry
MW0934            CDS       T00086                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-ProteinID: BAB94799
NITE: MW0934
UniProt: A0A0H3JWT1
Position
complement(1026251..1027261)
AA seq 336 aa
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacttcattaaaagagagagattatttttttgacaacgcaagagcaattttaatatta
ttagtcgtatttggacatatgttacaaccctacactagtggcgataaatatttatcagca
ttatacctagttatttatagtttccatatgccaacatttttgtttatatctggttatttc
gcgaaaaatattgataaaccatactatttagaaaaaatttcaaaacgtttgatagtacct
tatatgatattttttgcattcttttcaatttattatttcttaacaggtaaaagtgacgaa
ttacaacttgatccttttaacccagtatttgcgttatggtttttgatcacgctatttttc
tttcatgtcattttagtaatagttagaagatttaatccatataaagtgctatcagtttca
attattatatctattggagcaggtttttcagataacatcgatagctacttaagcatttca
aggacaatcgtatttttcccaatattttatctaggttacattttcaccaaaaaacatacg
gctatttttaaaaataaaaaactaataccagtatctatcattacctttattttgtttttt
atcgtttacgtgattcatcctatcaatgcagattggttattgggaagttcaccatatact
tcacttgaaaatgaaggacagagtatattcagtccttttaaacgacttatattatatgga
attatattaatcgcaatgactgcgtttctaaatttaatgtcaacaaagaaaaaattatat
acttatattggtagtcgtacgctatacgtatatttattacatggtttaattattggcatt
gttagaggatttgaatggtacccattcgataatcctatatcattaatgacttatctttat
ttaataagtatatctgtaatcatcgtatatgtattatctacaaactttgtttgtaaatgg
acaaatccaataattaatttacaaagaccatcacagtttaaagattcataa

DBGET integrated database retrieval system