KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0935
Entry
MW0935            CDS       T00086                                 

Name
(GenBank) ORFID:MW0935; hypothetical protein, probable ATL autolysin transcription regulator
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-ProteinID: BAB94800
NITE: MW0935
UniProt: A0A0H3K2M9
Position
1027414..1027833
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system