KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1119
Entry
MW1119            CDS       T00086                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09787  uncharacterized protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sam00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MW1119
SSDB
Motif
Pfam: UPF0122 Sigma70_r4 Sigma70_r4_2 HTH_38 HTH_11 HTH_23 Sigma70_ECF HTH_Tnp_1_2 HTH_7 HTH_10 HTH_28 HTH_17 TrmB HTH_40 HTH_29 DUF1492 Terminase_5 HTH_22 GerE Syntaxin-6_N AAA_23
Other DBs
NCBI-ProteinID: BAB94984
NITE: MW1119
UniProt: P67250
Structure
PDB: 
1XSV

Position
1221746..1222078
AA seq 110 aa
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
NT seq 333 nt   +upstreamnt  +downstreamnt
atgggtcaaaatgatttagttaaaacgttacgaatgaattatttgtttgatttttatcaa
tccttattgacgaataaacaacgtaattatttggaattattttatcttgaagattattct
ttaagtgaaatcgcagatacttttaatgtgagtagacaagcagtttatgataatataaga
agaactggcgatttagttgaagattatgaaaagaaattggaattataccagaaatttgag
caacgccgagaaatatatgatgaaatgaaacaacatttaagtaatccagaacaaatacaa
cgttatattcaacaattagaagacttagaatag

DBGET integrated database retrieval system