KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1397
Entry
MW1397            CDS       T00086                                 

Definition
(GenBank) hypothetical protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
SSDB
Motif
Pfam: Phage_connect_1
Other DBs
NCBI-ProteinID: BAB95262
NITE: MW1397
UniProt: A0A0H3K351
Position
complement(1549763..1550041)
AA seq 92 aa
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag

DBGET integrated database retrieval system