KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1762
Entry
MW1762            CDS       T00086                                 

Symbol
bsaD
Name
(GenBank) ORFID:MW1762; [Genomic island nu Sa beta2]; hypothetical protein, similar to lantibiotic epidermin biosynthesis protein EpiD
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
SSDB
Motif
Pfam: Flavoprotein HNH_2
Other DBs
NCBI-ProteinID: BAB95627
NITE: MW1762
UniProt: A0A0H3JWY8
Structure
PDB: 
3QJG

Position
complement(1912385..1912903)
AA seq 172 aa
MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEF
EDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRM
WENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggagaaaatgtattgatttgtttgtgtggctcagttaatagtatcaatattagccac
tatattattgaattaaaatcaaaatttgatgaagtaaatgtaatcgcgtcaacaaacggt
agaaagtttattaatggtgaaatattaaagcaattttgcgataactattatgacgaattt
gaagacccttttttaaatcatgtagatatagcaaataaacatgacaagattattatttta
cctgcgacttctaatacgattaataaaattgcaaatggtatatgtgacaatttattatta
actatttgtcatacagcttttgaaaaactttctatatttccaaatatgaatttacgaatg
tgggaaaatccagttactcaaaataatattcgattattaaaagattatggtgtatcaata
tatccagcaaatatttcagaaagttatgaattagcgtcaaaaacatttaaaaagaatgtt
gtcgcacctgaaccatataaagttctggaattcatttga

DBGET integrated database retrieval system