KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1839
Entry
MW1839            CDS       T00086                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00561  Glycerolipid metabolism
sam00564  Glycerophospholipid metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MW1839
   00564 Glycerophospholipid metabolism
    MW1839
Enzymes [BR:sam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     MW1839
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-ProteinID: BAB95704
NITE: MW1839
UniProt: Q7A0H3
Structure
PDB: 
2QV7 2QVL

Position
complement(2001004..2001951)
AA seq 315 aa
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa

DBGET integrated database retrieval system