KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2270
Entry
MW2270            CDS       T00086                                 
Name
(GenBank) hypothetical protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
SSDB
Motif
Pfam: PRP9_N DUF3567 LMP COOH-NH2_lig MSP7_C
Other DBs
NCBI-ProteinID: BAB96135
NITE: MW2270
UniProt: A0A0H3K1E3
Position
2415872..2416291
AA seq 139 aa
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagccatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaggttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa

DBGET integrated database retrieval system