KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2336
Entry
MW2336            CDS       T00086                                 

Definition
(GenBank) ORFID:MW2336; hypothetical protein, similar to ABC transporter, periplasmic amino acid-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam02010  ABC transporters
sam02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:sam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MW2336
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    MW2336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sam02000]
    MW2336
   02035 Bacterial motility proteins [BR:sam02035]
    MW2336
Transporters [BR:sam02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    MW2336
Bacterial motility proteins [BR:sam02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    MW2336
SSDB
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd InPase NMT1 SspK
Other DBs
NCBI-ProteinID: BAB96201
NITE: MW2336
UniProt: A0A0H3JY71
Position
complement(2484208..2484987)
AA seq 259 aa
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaagacttttatttgtgatgatagctttcgttttcatattggctgcatgcggaaac
aattcgtcgaaagacaaggaagctagtaaagatagcaagacaattaatgttgggactgag
gggacttatgcaccatttagtttccacgataaagatggtaaattaactggttacgatatt
gatgttattaaagcagtggctaaagaagaaggtttaaaacttaaatttaatgaaacttct
tgggattctatgtttgcaggtttagacgcagggcgttttgatgtaatcgcgaaccaagta
ggtattaatcctgatagagaaaagaaatataaattttctaagccttacacattctcaagt
gctgttttagttattcgtgaaaatgaaaaagatattaaagattttgatgatgttaaaggt
aagaagttagcacaaacattcacatctaattatggtaaattagctaaggataaaggtgct
gatattacaaaagttgatggctttaaccaatcaatggatttattattgtctaagcgtgtt
gatggtacatttaatgatagtctgtcatacttggattataaaaaacaaaaacctaatgct
aagatcaaagcaatcaaaggtaatgctgaacaaagtagatctgcatttgcattttctaaa
aaagcagatgatgaaacagttcaaaaattcaatgatggcttgaaaaaaatcgaggaaaac
ggtgaattagctaaaataggtaagaaatggtttggtcaagatgtttctaaatctaaatag

DBGET integrated database retrieval system