KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2457
Entry
MW2457            CDS       T00086                                 

Definition
(GenBank) ORFID:MW2457; hypothetical protein, similar to thioredoxin
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Motif
Pfam: Thioredoxin Thioredoxin_3 Cytochrom_C1 DUF5947 Ldh_1_C Phosducin Toxin-deaminase HyaE
Other DBs
NCBI-ProteinID: BAB96322
NITE: MW2457
UniProt: A0A0H3JYH5
Position
complement(2617932..2618276)
AA seq 114 aa
MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggttaagcaattaaatagtgtcgaagcattccgtgaatttattcatcaatatccgtta
gcagttgtacatgtcatgcgcgatcagtgtagcgtgtgtcatgccgttttaccacaaatt
gaagacttgatgcaatcatatcccaatgtgccattagctgtgattaatcaaagtcaggtg
gaagctattgctggagaattaaatattttcactgtacctgtggatttaatttttatgaat
ggaaaagaaatgcatcgtcaagggcgttttatcgatatgcaacgttttgaacatcatctt
aagcaaatgaatgatagtgtaaataacgatgtcgatgagcattaa

DBGET integrated database retrieval system