KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0090Help
Entry
MW0090            CDS       T00086                                 

Gene name
sbnB
Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00998  Biosynthesis of secondary metabolites - other antibiotics
sam00999  Biosynthesis of secondary metabolites - unclassified
sam01100  Metabolic pathways
Module
sam_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    MW0090 (sbnB)
   00999 Biosynthesis of secondary metabolites - unclassified
    MW0090 (sbnB)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     MW0090 (sbnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: BAB93955
NITE: MW0090
UniProt: A0A0H3JUW7
Structure
PDB: 

Position
106755..107765
Genome map
AA seq 336 aa AA seqDB search
MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagagatgttgtatttaaatagatcagatattgaacaagcgggaggtaatcat
tcacaagtttatgtggacgcattaacagaagcattaacagcccatgcgcacaatgatttt
gtacaaccgcttaagccgtatttaagacaggatcctgaaaatggacacatcgcagatcga
ataattgcaatgccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggata
ggtagtaagcacgacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattatt
ttgaatgatccagaaacgaattatccaattgcagttatggaagcaagtttaattagtagt
atgcgtactgcagcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaa
gacttaacaatcattggatgcgggctaatcggagacaagcaattacaaagtatgttagag
caattcgatcatattgaacgcgtgtttgtttacgatcaattctctgaagcatgtgcacgc
tttgttgatagatggcaacaacagcgtccggaaattaattttattgcgacagaaaatgct
aaagaagcagtatcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatac
attgaatatgattggttacaaaagggtgcatttattagcaacatttctatcatggatgtg
cataaagaagtctttattaaagctgacaaagtcgtagtagacgactggtcacaatgtaat
cgagaaaagaaaactattaaccaattggtgttagaaggtaaattcagcaaagaagcactt
catgctgaactaggacaacttgtgacaggtgacataccaggacgtgaagacgatgatgaa
atcatattacttaatccgatgggtatggctatcgaagatatttcaagtgcttactttatt
tatcaacaggcacaacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system