KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0357
Entry
MW0357            CDS       T00086                                 

Gene name
ahpC
Definition
(GenBank) alkyl hydroperoxide reductase subunit C
  KO
K24119  NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MW0357 (ahpC)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.26  NADH-dependent peroxiredoxin
     MW0357 (ahpC)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC NAGidase
Other DBs
NCBI-ProteinID: BAB94222
NITE: MW0357
UniProt: P0A0B6
Position
complement(403621..404190)
AA seq 189 aa
MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
PGLDLVGKI
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtcattaattaacaaagaaatcttaccatttacagcgcaagctttcgatccaaaaaaa
gatcaatttaaagaagttacacaagaagatttaaaaggttcttggagcgtagtatgcttc
tatcctgctgacttctcattcgtttgtccaactgaattagaagacttacaaaaccaatat
gaagaattacaaaaattaggcgtaaatgtattctcagtatcaactgatactcacttcgta
cacaaagcatggcatgaccattcagatgcaattagcaaaatcacttacactatgattggt
gacccatcacaaacaatcactcgtaattttgatgtattagatgaagctactggtttagct
caacgtggtacattcattatcgacccagacggtgttgtacaagcatctgaaattaacgct
gacggaattggccgtgacgctagtacattagctcacaaaatcaaagcagctcaatatgtt
cgtaaaaaccctggcgaagtatgcccagctaaatgggaagaaggcgctaaaacattgcaa
cctggtttagatttagtaggtaaaatctaa

DBGET integrated database retrieval system