KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW0531Help
Entry
MW0531            CDS       T00086                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00071  Fatty acid degradation
sam00072  Synthesis and degradation of ketone bodies
sam00280  Valine, leucine and isoleucine degradation
sam00310  Lysine degradation
sam00362  Benzoate degradation
sam00380  Tryptophan metabolism
sam00620  Pyruvate metabolism
sam00630  Glyoxylate and dicarboxylate metabolism
sam00640  Propanoate metabolism
sam00650  Butanoate metabolism
sam00900  Terpenoid backbone biosynthesis
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
sam01212  Fatty acid metabolism
sam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MW0531 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    MW0531 (vraB)
   00640 Propanoate metabolism
    MW0531 (vraB)
   00650 Butanoate metabolism
    MW0531 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MW0531 (vraB)
   00072 Synthesis and degradation of ketone bodies
    MW0531 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MW0531 (vraB)
   00310 Lysine degradation
    MW0531 (vraB)
   00380 Tryptophan metabolism
    MW0531 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MW0531 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MW0531 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MW0531 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sam04147]
    MW0531 (vraB)
Enzymes [BR:sam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MW0531 (vraB)
Exosome [BR:sam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MW0531 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAB94396
NITE: MW0531
UniProt: Q7A1P9
Position
619167..620306
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagtgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system