KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1034Help
Entry
MW1034            CDS       T00086                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MW1034
Enzymes [BR:sam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     MW1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAB94899
NITE: MW1034
UniProt: P58995
Structure
PDB: 

Position
1132889..1133476
Genome map
AA seq 195 aa AA seqDB search
MKEIVIASNNQGKINDFKVIFPDYHVIGISELIPDFDVEETGSTFEENAILKSEAAAKAL
NKTVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTDRRAQFVCVIS
MSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQKGQISHRRN
AINLLQAFLEGDKNV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagattgttattgcatcgaataatcaagggaaaataaatgactttaaagtaata
tttccagattaccacgtaataggtatttcagaactaataccagattttgatgtggaagaa
acaggatcaacatttgaagaaaatgctatattaaaatcagaagctgctgcaaaagcattg
aataaaacagtcatagctgatgacagtggactagaagtttttgcattaaatggtgagcca
ggtatatactctgcacgttatgctggtgaaaataaaagcgatgaagcaaatattgaaaaa
ttattaaataagcttggtaatacaactgatcgtcgtgcgcaatttgtttgtgtcataagt
atgagtggccctgatatggaaacaaaagtatttaaaggtactgtttcaggtgaaattgca
gatggaaaatatggcgaaaatggtttcggatatgatccgatattttatgtaccgaaatta
gataaaaccatggctcaactttcaaaagaacaaaaagggcaaattagtcatagacgaaat
gcgattaatttacttcaagcttttcttgaaggtgataaaaatgtctaa

DBGET integrated database retrieval system