KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1259Help
Entry
MW1259            CDS       T00086                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00260  Glycine, serine and threonine metabolism
sam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01130  Biosynthesis of antibiotics
sam01230  Biosynthesis of amino acids
Module
sam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MW1259 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MW1259 (trpB)
Enzymes [BR:sam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MW1259 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAB95124
NITE: MW1259
UniProt: Q8NWU2
Position
1378936..1380150
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatatggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgacaccacttacatatgctgcatcatatactgaaagcctaggtggcgctaaaata
tatttgaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgcttgctaaaagaatgggcaagaagaagcttgttgctgaaactggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagatggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccgttcccaacgattgttagagattttcagagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcattatacggt
gttgaagccgcaggtcaaggcgatgatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaagatgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattggaccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgctagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggtagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system