KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1791Help
Entry
MW1791            CDS       T00086                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sam03009]
    MW1791
Enzymes [BR:sam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MW1791
Ribosome biogenesis [BR:sam03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MW1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BAB95656
NITE: MW1791
UniProt: A0A0H3K3R0
Position
1946212..1947033
Genome map
AA seq 273 aa AA seqDB search
MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaataccagaaaactttaatgacttaagtttacgagatattttccaacaa
cttaaggtacctaaaaaagatttacatcatttaaatatgtctaaagatattactattaat
gataaacctgcgcgattaatggataaagtgcatactggcgacgatgtatttgttccaacc
atcgatgaaaaaagtaattatgttccaagttatcgttatgcacaaattaaatacgaagac
gatgatatggcaatcgtaatgaaacctaaaggtgttaagactcaccctaatgatttaaaa
gaaagcaatactttaatgaatcatgtgatttacactattgatagtgactatgtcgaacca
attcatcgactggaccaggaaacagtaggattattaattgttgctaaaaatcctttaatg
aaaaaaattcttgatcgcatgttagaagacaatgatattacgcggatatacaaagcaaat
gttaaggcacttttacctttgaaaccacaaacgattgatatgccaattggtaaagataaa
ttccattcgaataaacgacgtgtgtctcctactggacagcgtgcaattacacacatttta
acttcaaaaatgataaaagaagctgtgtgccaacttgaaatcaagttggatactggacgt
actcatcaaattcgtgtgcatttagctgaaattggtcaccctgttattggtgatccttta
tatggtgattcaacgttaagacaattagaacttgaaagttacaaaatagagtttgtgcat
cccttgactaaggaagtcatttccgtttctttggatgactaa

DBGET integrated database retrieval system