KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1943Help
Entry
MW1943            CDS       T00086                                 

Definition
(GenBank) ORFID:MW1943; hypothetical protein, similar to succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00300  Lysine biosynthesis
sam01100  Metabolic pathways
sam01120  Microbial metabolism in diverse environments
sam01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sam00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MW1943
Enzymes [BR:sam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MW1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAB95808
NITE: MW1943
UniProt: Q8NVL7
Position
2092394..2093617
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANIVAEI
GNGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLIIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSELKQQDTKHELDVAPMFKSLIGK
EISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIIND
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQDEIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIKYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatatcgttgcagaaatc
ggtaacggctcacctatactcgcattgagtggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagctggcaaattatacggt
cgaggcacaacggatatgaaaggcggtctgatggctttggtcatcacactcattgaatta
aaagaacaaaatcaattgcctcaaggaacgataagattactagctactgctggcgaagag
aaagaacaagaaggtgccaaattattagctgataaaggctatttagacgatgtcgatggc
ttaattattgctgaaccaactggatctggaatttattatgcacataaggggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatctatttaaagaaaaatattcagagcttaaa
caacaagatactaaacatgaattagatgttgcgcctatgttcaaatcattgattggaaaa
gaaatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggcaaacaatttaactctgtaccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaatgat
gtggatagcaataagctttcactcgatattccaagcaatcaccgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagaacaagac
gaaatatttgtttcagcgcttgtaggtgcaacagatgcctctagtttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatatttttaaagaggcttcc
attaaatatttaaaagagaaataa

DBGET integrated database retrieval system