KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2466Help
Entry
MW2466            CDS       T00086                                 

Gene name
mvaA
Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00900  Terpenoid backbone biosynthesis
sam01110  Biosynthesis of secondary metabolites
sam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MW2466 (mvaA)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MW2466 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red YAcAr UPF0180
Motif
Other DBs
NCBI-ProteinID: BAB96331
NITE: MW2466
UniProt: A0A0H3JYB3
Position
complement(2626758..2628038)
Genome map
AA seq 426 aa AA seqDB search
MQNLDKNFRHLSRKEKLQQLVDKQWLSEEQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNEFPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQDRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVESAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAKVAEALKKEPRANTQAAERILQ
DLRSQQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttagataagaattttcgacatttatctcgtaaagaaaagttacaacaattg
gttgataagcaatggttatcagaagaacaattcgacattttactgaatcatccattaatc
gatgaagaagtagccaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagcgattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaattt
ccgcaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgatgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcacaagtagatattcatcgtgcagcaaca
cataataaaggtgttatgaatggcatacatgctgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcaagtcgtgacggacagtatcgtggtatt
gctacatggcgttacgatcaagatcgtcaacgattgattggtacaattgaagtgcctatg
acattggcaattgttgggggtggtacgaaagtattaccaatagctaaagcttcattagag
ctactaaatgtagagtcagcacaagaattaggtcatgtagttgctgccgttggtttagcg
caaaactttgcagcatgtcgcgcgcttgtgtcagaaggtattcaacaaggtcatatgagt
ttacaatataaatcattagctattgttgtaggagcaaaaggtgatgaaattgctaaagta
gctgaagctttgaaaaaagaaccccgtgcaaatacacaagcagcggaacgtattttacaa
gatttaagaagccaacaatag

DBGET integrated database retrieval system