KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2526Help
Entry
MW2526            CDS       T00086                                 

Gene name
mqo2
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00020  Citrate cycle (TCA cycle)
sam00620  Pyruvate metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
Module
sam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MW2526 (mqo2)
   00620 Pyruvate metabolism
    MW2526 (mqo2)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MW2526 (mqo2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAB96391
NITE: MW2526
UniProt: Q8NUM4
Position
complement(2690198..2691694)
Genome map
AA seq 498 aa AA seqDB search
MAKSNSKDIVLIGAGVLSTTFGSMLKEIEPDWNIHVYERLDRPAIESSNERNNAGTGHAA
LCELNYTVLQPDGSIDIEKAKVINEEFEISKQFWGHLVKSGSIENPRGFINPLPHISYVR
GKNNVKFLKDRYEAMKAFPMFDNIEYTEDIEVMKKWIPLMMKGREDNPGIMAASKIDEGT
DVNFGELTRKMAKSIEAHPNATVQFNHEVVDFEQLSNGQWEVTVKNRLTGEKFKQVTDYV
FIGAGGGAIPLLQKTGIPESKHLGGFPISGQFLACTNPQVIEQHDAKVYGKEPPGTPPMT
VPHLDTRYIDGQRTLLFGPFANVGPKFLKNGSNLDLFKSVKTYNITTLLAAAVKNLPLIK
YSFDQVIMTKEGCMNHLRTFYPEARNEDWQLYTAGKRVQVIKDTPEHGKGFIQFGTEVVN
SQDHTVIALLGESPGASTSVSVALEVLERNFPEYKTEWAPKIKKMIPSYGESLIEDEKLM
RKIRKQTSKDLELGYYEN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctaatagtaaagacatcgttttaattggagccggtgtacttagcacaaca
tttggttcaatgttaaaagaaattgagccagactggaatatccacgtttacgaacgcttg
gatcgtcctgcaatcgaaagttcaaacgaaagaaataatgctggtacgggtcatgcagca
ttatgtgagttgaactacacagttttacaacctgatggttctatcgacatcgaaaaagcg
aaagtgattaacgaagagtttgagatttcaaaacaattctggggtcacttagtgaaaagc
ggtagcatcgagaacccaagaggatttatcaatccattaccacacatcagttatgttaga
ggtaaaaacaatgttaaattcttaaaagatcgttacgaagcgatgaaagctttccctatg
ttcgataatatcgaatatactgaagacatcgaagtaatgaaaaaatggattccattgatg
atgaaaggccgtgaagataaccctggtatcatggcggcaagtaaaattgacgaaggtaca
gatgtaaacttcggtgaattaacacgtaaaatggctaaaagcattgaagcacatccaaat
gctacagtgcaatttaaccatgaagttgttgattttgaacaattatcaaatggtcaatgg
gaagttactgttaaaaatcgcctaactggtgagaaattcaaacaagtaactgactatgta
ttcatcggtgctggcggtggagcgattccattattacaaaaaacaggtatccctgaaagt
aaacatttgggtggattccctatcagtggtcaattcttagcttgtacaaacccacaagtt
attgaacaacacgatgccaaagtttatggtaaagagccacctggtacaccaccaatgact
gtacctcatttagatacgcgttacattgacggccaaagaacattgttatttggaccattt
gctaatgttggacctaaattcttgaaaaatggttctaacttagatttattcaagtctgtt
aaaacatacaacattacaactttattagcagcagcagttaaaaacttacctttaattaaa
tactcatttgaccaagtaattatgacaaaagaaggttgtatgaaccacttacgtactttc
tatccagaagcacgtaatgaagattggcaattatacactgctggtaaacgtgtacaagtt
atcaaagatacacctgaacacggtaaaggattcatccaattcggtacagaagtggttaac
tcacaagaccacactgtaatcgcattattaggtgaatcaccaggggcttcaacttcagtt
tcagttgcgttagaagtattagaacgtaacttccctgaatacaaaactgaatgggcacct
aaaatcaagaaaatgattccatcatacggtgaatcattaattgaagacgaaaaattaatg
agaaaaatccgtaaacaaacttcaaaagacttagaattaggttactacgaaaactaa

DBGET integrated database retrieval system