KEGG   Streptomyces ambofaciens: SAM23877_1113Help
Entry
SAM23877_1113     CDS       T04055                                 

Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00471  D-Glutamine and D-glutamate metabolism
samb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAM23877_1113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:samb01011]
    SAM23877_1113
Enzymes [BR:samb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SAM23877_1113
Peptidoglycan biosynthesis and degradation proteins [BR:samb01011]
 Precursor biosynthesis
  Racemase
   SAM23877_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF498 Phage_BR0599
Motif
Other DBs
NCBI-ProteinID: AKZ54162
UniProt: A3KJX1
Position
complement(1134751..1135593)
Genome map
AA seq 280 aa AA seqDB search
MRSLPHDRGPERTIVYGGRVKIALMDSGIGLLAATAAVRRLRPDADLILSLDPDGMPWGP
RTPEDLTGRALAVAEAAAAHRPDALIVGCNTATVHALPALRARFEPALPVIGTVPAIKPA
AAGGGPVAIWATPATTGSPYQRDLIERFGGEATVTEVPCPGLADAVEHADEAAITAAVAA
AAALTPGDVTTVVLGCTHYELVAERIRAAVQRPGAPRLVLHGSAGAVAAQALRRIGVRPD
PGAPAEGTLTVLLSGREGALPAAALTYDEGRLLRTVTPAR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagtctgccccacgacaggggcccggagcggaccatcgtctatggtggccgggtg
aagatcgcgctcatggactccggaatcggtctgctggcggccaccgccgcggtacggcgc
ctgcgaccggacgccgatctcatcctctccctcgaccccgacggcatgccctggggcccg
cgtacccccgaggacctgaccggtcgcgccctcgccgtcgccgaggccgccgccgcgcac
cgtccggacgccctgatcgtcggctgcaacaccgccaccgtgcacgcgctgcccgcgctg
cgcgcccgattcgaacccgcactgccggtcatcggcaccgtgccggcgatcaaacccgcc
gcggcgggcggcgggcccgtggcgatctgggcgacgcccgccaccaccggcagcccgtac
cagcgcgatctcatcgagaggttcggcggcgaagcgacggtcaccgaagtgccgtgtccg
gggctcgccgacgccgtcgagcacgcggacgaggccgcgatcaccgcggccgtcgccgcg
gcggccgccctcacccccggcgacgtgacgaccgtcgtcctgggctgcacccactacgaa
ctggtcgccgaacgcatccgcgccgccgtgcagcgccccggggccccgcgcctcgtcctg
cacggctccgccggtgcggtcgcggcacaggccctgcgccggatcggtgtccgtcccgat
cccggagccccggccgagggcaccctcaccgtgctgctgagcggacgcgagggcgcgctg
cccgcggccgcgctgacgtacgacgagggccggctcctgcgtacggtgacccccgcgcgc
tga

DBGET integrated database retrieval system