KEGG   Streptomyces ambofaciens: SAM23877_1915Help
Entry
SAM23877_1915     CDS       T04055                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00051  Fructose and mannose metabolism
samb01100  Metabolic pathways
samb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAM23877_1915 (fucA)
Enzymes [BR:samb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SAM23877_1915 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AKZ54964
UniProt: A0A0K2APQ5
Position
complement(1977932..1978603)
Genome map
AA seq 223 aa AA seqDB search
MTRSMGGRAESEVAEAWEALVATARRTVADGLVVGTSGNVSVRVGDTVLVTPSGVPYDRL
APADATGVDLDGRQVLGTLVPTSELPMHLAVYRATDARAVVHTHAVHATAVSLLVPELPP
VHYMTAALGGPVRVARYAAYGTDELARTMLDALTGRTGCLLQNHGTITYGASLDQAYDRT
AQLEWMCRLWLTASAVPGRSPSLLTEEQLAEVAERLRGYGQRS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgatcgatgggcggacgggcggaatcggaggtggccgaggcctgggaggccctc
gtcgcgacggcccggcggacggtggcggacgggctggtggtcggcacctccggcaacgtc
tcggtgcgcgtcggcgacacggtgctggtcactccttcgggggtgccgtacgaccgtctg
gccccggccgacgcgaccggcgtcgacctcgacggccggcaggtcctcggcacgctggtc
cccaccagcgaactgcccatgcacctcgccgtgtaccgggccaccgacgcccgggccgtc
gtccacacccacgccgtgcacgcgacggcggtctcgctgctcgtgcccgaactgccgccg
gtccactacatgaccgccgcgctcggcggcccggtccgggtcgcccgctacgcggcctac
ggcaccgacgaactggcccgcaccatgctcgacgccctcaccggccgcaccggctgcctc
ctccagaaccacggcacgatcacctacggcgcctccctggaccaggcctacgaccgcacc
gcccagctggagtggatgtgccgcctctggctgacggcctccgcggtaccgggccggtcc
ccgtccctgctgaccgaggagcagctcgccgaggtggcggagcgcctccgggggtacggc
cagcggtcctga

DBGET integrated database retrieval system