KEGG   Streptomyces ambofaciens: SAM23877_5788Help
Entry
SAM23877_5788     CDS       T04055                                 

Gene name
cyc
Definition
(GenBank) Germacradienol/geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00909  Sesquiterpenoid and triterpenoid biosynthesis
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SAM23877_5788 (cyc)
Enzymes [BR:samb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     SAM23877_5788 (cyc)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     SAM23877_5788 (cyc)
    4.2.3.75  (-)-germacrene D synthase
     SAM23877_5788 (cyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AKZ58833
UniProt: A0A0K2B0U1
Position
6269614..6271794
Genome map
AA seq 726 aa AA seqDB search
MTQQPFELPHFYLPHPARLNPHLDEARAHSTTWAREMGMLEGSGVWEQSDLDAHDYGLLC
AYTHPDCDGPALSLITDWYVWVFFFDDHFLEKFKRTQDRVGGKTHLDRLSLFMPLDLAAG
MPEPENPVEAGLADLWTRTVPAMSAEWRRRFAVATEHLLNESLWELSNINEGRIANPVEY
IEMRRKVGGAPWSAGLVEYATAEVPTAVAGSRPLRVLMETFSDAVHLRNDLFSYQREVED
EGELSNGVLVLETFFGCTTQEAAELVNDVLTSRLHQFEHTAFTEVPAVALENGLSPAEVA
AVGAYAKGLQDWQSGGHEWHMRSSRYMNKGARPAAGWQALTGPGTSAADVGALLTAAAAG
RRRPYTYVPFQKVGPSVIPDIRMPFPLELSPALEGARRHLSEWCRAMGILSEGVWDQDKL
ASCDLPLCAAGLDPDATQEQLDLASGWLAFGTYGDDYYPLVYGHRRDLAAARLTTARLSA
CMPLDGEPVPPPANAMERSLIDLWTRTTAGMTPGQRRPLKTAVDKMTEAWVWELANQIQN
RVPDPVDYLEMRRATFGSDLTLGLCRAGHGPAVPPEVYRSGPVRSLENAAIDYACLLNDV
FSYQKEIEYEGEIHNAILVVQNFFGVDYPAALTVVQDLMNQRMRQFEHVVAHELPVVYDD
FRLSDEARGVMAGYVTDLQNWMAGILNWHREVPRYKADYLARRTHGFLPDRIPAVPVPRL
STVPTA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacagcccttcgaactcccgcacttctacctgccgcatcccgcccggctcaac
ccgcatctcgacgaggcccgcgcccactcgacgacgtgggcgcgcgagatgggcatgctg
gagggttccggggtctgggagcagtccgacctcgacgcgcacgactacggcctgctctgc
gcctacacccaccccgactgcgacggcccggcgctctccctcatcaccgactggtacgtg
tgggtcttcttcttcgacgaccacttcctggagaagttcaagcgcacccaggaccgcgtc
ggcggcaagacccatctcgaccggctctccctgttcatgccgctcgacctcgccgccggg
atgcccgagccggagaatccggtggaggccggcctcgccgacctgtggacgcgcacggtg
ccggcgatgtcggccgagtggcgccgccgcttcgccgtcgccaccgagcacctgctcaac
gagtccctgtgggagctgtccaacatcaacgaggggcggatcgccaaccccgtcgagtac
atcgagatgcgccgcaaggtcggcggcgccccctggtcggcggggctggtcgagtacgcg
accgccgaggtgcccaccgccgtcgccggctcccggccgctgagggtgctgatggagacg
ttctccgacgccgtgcacctgcgcaacgacctcttctcctaccagcgcgaggtcgaggac
gagggggagctgagcaacggggtgctggtcctggagaccttcttcggctgcaccacccag
gaggccgccgagctggtcaacgacgtcctcacctcccggctgcaccagttcgagcacacg
gcgttcaccgaagtgcccgcggtggcactggagaacggcctgtcgccggccgaggtcgcc
gccgtcggggcgtacgcgaagggcctccaggactggcagtccggcggccacgagtggcac
atgcgctccagccggtacatgaacaagggcgcccggcccgccgccggctggcaggcgctg
accggccccggcacctccgccgcggacgtcggcgcgctgctgaccgcggctgccgccgga
cggaggcgtccctacacctatgtgccgttccagaaggtcggcccctcggtcatccccgac
atccgcatgcccttcccactggagctgagcccggccctggagggcgcccgacggcacctg
tccgaatggtgccgggcgatgggcatcctcagcgagggggtatgggaccaggacaagctc
gcgagctgcgacctgcccctgtgcgccgcgggcctggacccggacgccacccaggagcag
ctggacctcgcctccggctggctggccttcggcacctacggcgacgactactacccgctg
gtctacggccaccgccgtgacctggccgccgcccggctgaccacggcccggctgtcggcc
tgcatgccgctcgacggcgagccggtcccgccgccggccaacgccatggaacgctccctg
atcgacctgtggacccgcacgaccgccggcatgacgcccggccagcggcgcccgctgaag
acggccgtggacaagatgaccgaggcctgggtgtgggagctggccaaccagatccagaac
cgcgtccccgacccggtggactacctggagatgcggcgcgccaccttcggctccgacctc
acgctgggcctgtgccgtgccggacacggcccggccgttccgcccgaggtctaccgcagc
gggcccgtccgttccctggagaacgcggcgatcgactacgcgtgcctgctcaacgacgtc
ttctcgtaccagaaggagatcgagtacgagggcgagatccacaacgcgatcctcgtcgtg
cagaacttcttcggcgtcgactatccggccgcgctcaccgtcgtgcaggacctgatgaac
cagcgcatgcgccagttcgagcacgtcgtcgcgcacgaactgccggtcgtgtacgacgac
ttccggctgagcgacgaggcgcgcggcgtcatggcgggctatgtgaccgacctgcagaac
tggatggcgggcatcctcaactggcatcgggaggtgccgcggtacaaggccgactacctg
gcccggcgcacccacggcttcctcccggaccggatcccggccgtacccgtgcccaggctc
agcaccgtgccgacggcctga

DBGET integrated database retrieval system