KEGG   Streptomyces ambofaciens: SAM23877_6251Help
Entry
SAM23877_6251     CDS       T04055                                 

Definition
(GenBank) Chitinase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00500  Starch and sucrose metabolism
samb01100  Metabolic pathways
samb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAM23877_6251
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAM23877_6251
Enzymes [BR:samb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SAM23877_6251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2
Motif
Other DBs
NCBI-ProteinID: AKZ59296
UniProt: A0A0K2B2B9
Position
6720186..6721913
Genome map
AA seq 575 aa AA seqDB search
MTRSRTAMLAALTLVAGASGTALAAHSASAGAAAVPCTVDYKVQNDWGSGFTAAVTVTNN
GAATSSWSLGWTYAGSQKVTNSWNAKVSQSGAAVTVANESYNGTLSTGGSASFGFQGTYS
GSNAVPATFKLNGVTCNVDDGGSTDPDPTDPPDPGGPSDRVNNPYAGAKVYVNPEWSEKA
AAEPGGSRIANQPTGVWLDRIAAINGVNGGMGLRDHLDEALTQKGSGELAVQLVIYNLPG
RDCAALASNGELGPTEIDKYKTQYIDPIAAILADPKYAGLRIVTTVEIDSLPNLVTNVSG
RPTATPNCDVMKANGNYQKGVGYALNKLGDIDNVYNYVDAGHHGWLGWDSNFGPSADMFK
TAATTEGATVSDVHGFIVNTANYSALKEENFKITDSVNGTSVRQSKWVDWNQYTDELSYA
QAMRDKLVSLGFDQNLGMLIDTSRNGWGGTARPTGPGATTNVDTYVNGGRYDRRIHLGNW
CNQAGAGLGERPKASPAAGIDAYVWMKPPGESDGASKEIPNDEGKGFDRMCDPTYEGNAR
NGNSPSGALGDAPVSGHWFSAQFQELMKNAYPPLS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtagcagaaccgcgatgctcgccgccctgacgctggtcgcaggggcctccggc
accgctctcgccgcccactccgcgagcgccggcgcggcagccgtcccctgtaccgtcgac
tacaaggtgcagaacgactggggcagcggcttcaccgccgccgtgaccgtcaccaacaac
ggtgcggccacctccagctggtcgctcggatggacgtacgccggcagccagaaggtcacc
aacagctggaacgcgaaggtcagtcagagcggtgccgccgtcaccgtggccaacgagtcc
tacaacggcaccctgtccacggggggttcggcgagcttcggtttccagggcacctacagc
ggcagcaacgccgtcccggccaccttcaagctcaacggtgtgacctgcaacgtcgacgac
ggcggttcgaccgacccggacccgaccgatccgccggaccccggtggcccctccgaccgg
gtgaacaacccctacgccggtgccaaggtctacgtgaaccccgagtggtccgagaaggcc
gccgccgagccgggcggctcccgtatcgcgaaccagcccaccggcgtgtggctcgaccgg
atcgccgcgatcaacggcgtgaacggcggcatggggctgcgcgaccacctcgacgaggcg
ctgacgcagaagggctccggcgaactcgccgtgcagctcgtcatctacaacctgcccggc
cgtgactgcgcggccctcgcctccaacggcgagctgggcccgacggagatcgacaagtac
aagacgcagtacatcgacccgatcgccgcgatcctcgccgacccgaagtacgcgggcctc
aggatcgtcaccaccgtggagatcgactcgctgcccaacctggtcaccaacgtctccggg
cggccgaccgccacgccgaactgcgacgtgatgaaggccaacggcaactaccagaagggc
gtcggctacgccctgaacaagctcggcgacatcgacaacgtctacaactacgtcgacgcc
ggacaccacggctggctcggctgggacagcaacttcggcccctccgccgacatgttcaag
accgccgccaccaccgagggcgcgaccgtctccgatgtgcacggcttcatcgtcaacacc
gccaactacagcgccctgaaggaggagaacttcaagatcacggactcggtgaacgggacc
tccgtgcgccagtccaagtgggtcgactggaaccagtacaccgacgagctgtcctacgcc
caggccatgcgcgacaagctggtctcgctcggcttcgaccagaacctcggcatgctgatc
gacacctcccgcaacggctggggcggcaccgcccggcccaccggaccgggcgcgacgacc
aacgtggacacctacgtcaacggcgggcgctacgaccgccgcatccacctcggcaactgg
tgcaaccaggccggagccggcctcggtgaacgcccgaaggcctctcccgccgccgggatc
gacgcgtacgtctggatgaagcccccgggcgagtccgacggcgcgagcaaggagatcccg
aacgacgagggcaagggcttcgaccggatgtgcgaccccacgtacgagggcaacgcgcgc
aacggcaacagcccctcgggcgccctgggcgacgccccggtgtccggccactggttctcc
gcgcagttccaggagctgatgaagaacgcctacccgccgctgtcctga

DBGET integrated database retrieval system