KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch0062Help
Entry
SAMCFNEI73_Ch0062 CDS       T04621                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
same  Sinorhizobium americanum
Pathway
same00620  Pyruvate metabolism
same00630  Glyoxylate and dicarboxylate metabolism
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
same01200  Carbon metabolism
Module
same_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMCFNEI73_Ch0062 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMCFNEI73_Ch0062 (glcB)
Enzymes [BR:same01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAMCFNEI73_Ch0062 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: APG89404
UniProt: A0A1L3LH23
Position
67320..69497
Genome map
AA seq 725 aa AA seqDB search
MDRVEKHDLKIDAGLHRFLVDEATPGTGVDPDHFLAALSQLVHELGPKNRLLLAKRDDLQ
AKLDAWYREHGAPLDMGAYQTFLKEIGYLLPEGPGFSVSTANVDPEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIADRDGAERGKGYNPARGAKVIAWVRDFLDASAPL
ATGRWSDVAGLAIDGPTLSLTLASGARTTLRNPAQFAGYSGTVAAPSEIVLRQNNLHIVI
VLDAKTPIGQADTAGISDVILESAITTIMDCEDSVAAVDGDDKVVVYRNWLGLMKGDLAE
EVAKGGRTFTRRLNPDRVFTRPDGATLTLPGRSLMLVRNVGHLMTNPAILDRDGREVPEG
LMDAMVTALIALHDIGPNGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPE
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLDCGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQAGLKSRPRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MAEIVDRQNAGDPNYHPMAGRFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QAAQQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaacatgatctgaagatcgatgcgggtctccaccgcttccttgtc
gacgaggcgacgccggggaccggtgtcgatccggaccattttcttgcggccctctcgcaa
ctcgtccacgaactcggtccgaagaaccgccttcttctcgccaagcgcgacgaccttcag
gccaagctcgatgcctggtatcgcgaacatggcgcgcccctcgatatgggggcctaccag
accttcctcaaagagatcggctatctcctgccggaagggccgggcttctccgtctcgacc
gccaatgtcgacccggagatcgcgaccattgccggcccgcagctcgtcgtgccggtgatg
aatgcccgctatgcgctgaacgccgccaatgcgcgctggggctcgctctatgacgcgctc
tacggcaccgacgccattgccgacagggacggagccgagcgcggcaagggctataatccg
gcgcgcggtgccaaggtcatcgcctgggtccgggactttctcgatgcgagcgcgccgctc
gcgacaggccgctggagcgacgtcgccggactggcaattgacgggccaactctctcgctg
accttggcgagcggcgccaggacgacgcttcgcaatccggctcagttcgccggctattcc
ggaaccgtagcggcgccatccgagatcgttctgcgccagaacaatctccacatcgtcatc
gtcctcgatgcgaagacgccgatcggccaggccgatacggccggcatttccgacgtcatc
ctcgaatcggcgatcaccacgatcatggattgcgaggattcggtcgccgccgtcgacggc
gatgacaaggtcgtcgtctatcgcaactggctcgggctgatgaagggcgaccttgcggaa
gaggtcgccaagggcggccggaccttcacccgcaggctgaaccccgaccgcgtcttcacc
aggccggacggcgctacgctgacgctgcccggccgctcgctgatgctggtgcgcaatgtc
gggcatctgatgactaacccggcgatcctcgaccgggacggccgcgaggtgcccgaaggc
ctgatggacgccatggtgacggcgctgatcgcgctgcacgacatcggcccgaatggccgg
cgggcaaactcccgctcgggctcgatgtatgtggtcaagccgaagatgcatgggcctgag
gaggtggcctttgcctgcgagatttttgcgcgcgtcgaggccgcacttgggcttccggaa
aacaccatcaagatgggcatcatggacgaggaacggcgcacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgagcgcgtcgttttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccatacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatcggtgcctacgagaactggaacgtcgatatcggcctcgactgcggg
ctttccgggcatgcccagatcggcaagggtatgtgggccatgcccgacctgatggcggcg
atgctcgagcagaagatcgcccatccgaaggccggcgccaacaccgcctgggttccctcg
ccgacggcggcgacgctgcatgcgacgcattaccaccgcgtcaacgtcgccgaggttcag
gcaggtctcaagagccggccgcgggccaagctcgcggatattctatcggtgcccgtggcg
gcgcggccgaactggacggaagaagagatccagcgcgaactcgacaacaacgcccagggc
atcctcggctatgtcgtgcgctgggtcgaccagggcgtcggctgctcgaaggttcccgac
atcaacaatgtcggcctgatggaagaccgggcgacactgcgcatctcggcccagcacatg
gccaactggctgcaccacggcatcgtcagcgaggcgcagatcgtcgagacgatgaagcgc
atggcggagatcgtcgaccggcagaatgccggcgatccgaactatcacccgatggccggc
cgattcgacgattcgattgccttccaggcggcgctggatctggtgctcaagggccgcgaa
cagccgaacggctataccgaaccggtgctgcaccgccggcggctggagttgaaggcgaag
caggcggcacagcaataa

DBGET integrated database retrieval system