KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch0511Help
Entry
SAMCFNEI73_Ch0511 CDS       T04621                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
same  Sinorhizobium americanum
Brite
KEGG Orthology (KO) [BR:same00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SAMCFNEI73_Ch0511 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APG89841
UniProt: A0A1L3LIB7
Position
complement(517945..518346)
Genome map
AA seq 133 aa AA seqDB search
MSNMYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSEIAVRLMTRYWHITDE
NGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFNVAIPA
FSLDSPGLVRTLN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatgtaccgtgcgctgacacgcgacatagaggtcacggtggagccgtactat
ctcgaagaacaatcggatccggatgatagccgctatgtctggggctaccgcatcgtcata
tcgaaccattccgaaatcgcggttcggctgatgacccgctactggcacatcaccgacgag
aacggccaggtggacgaggtgagcggtccaggcgtcatcggcgagcagccgcttctcaat
cccggcgacacctacgaatattcctccggctgcccgctcgacaccccctccggcgtcatg
ttcggccactacagcatggaggccgagggcggggagaccttcaatgttgccatccccgcc
ttttcgctcgattctcccggactggtgcggacgctgaactag

DBGET integrated database retrieval system