KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch0526Help
Entry
SAMCFNEI73_Ch0526 CDS       T04621                                 

Gene name
fadA
Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
same  Sinorhizobium americanum
Pathway
same00071  Fatty acid degradation
same00072  Synthesis and degradation of ketone bodies
same00280  Valine, leucine and isoleucine degradation
same00310  Lysine degradation
same00362  Benzoate degradation
same00380  Tryptophan metabolism
same00620  Pyruvate metabolism
same00630  Glyoxylate and dicarboxylate metabolism
same00640  Propanoate metabolism
same00650  Butanoate metabolism
same00900  Terpenoid backbone biosynthesis
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
same01130  Biosynthesis of antibiotics
same01200  Carbon metabolism
same01212  Fatty acid metabolism
same02020  Two-component system
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMCFNEI73_Ch0526 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMCFNEI73_Ch0526 (fadA)
   00640 Propanoate metabolism
    SAMCFNEI73_Ch0526 (fadA)
   00650 Butanoate metabolism
    SAMCFNEI73_Ch0526 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMCFNEI73_Ch0526 (fadA)
   00072 Synthesis and degradation of ketone bodies
    SAMCFNEI73_Ch0526 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMCFNEI73_Ch0526 (fadA)
   00310 Lysine degradation
    SAMCFNEI73_Ch0526 (fadA)
   00380 Tryptophan metabolism
    SAMCFNEI73_Ch0526 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMCFNEI73_Ch0526 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMCFNEI73_Ch0526 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMCFNEI73_Ch0526 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:same04147]
    SAMCFNEI73_Ch0526 (fadA)
Enzymes [BR:same01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMCFNEI73_Ch0526 (fadA)
Exosome [BR:same04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMCFNEI73_Ch0526 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5423
Motif
Other DBs
NCBI-ProteinID: APG89855
UniProt: A0A1L3LII5
Position
complement(530368..531576)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTSTVDDIVMGCVDP
VMDAGSVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGSWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAADA
WEKGYFENSVVPVKDQNGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVAIQA
HPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGESMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRFMQAFDIAHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgcctcgcggccgtggcaagaaggac
ggatctctgcacgaagtgccgtccgtccggctcgccgccaaggtgctcgaggcggtccgc
gaccgcaacgggctcgacacgtcgactgtcgatgacatcgtcatgggctgcgtcgatccg
gtgatggatgccggttcggtgatccccaaggccgccgccttcgaggccggctactcgacg
cgggcgcccggcatgcagatctcgcgcttctgcgcctccggcctcgatgccgtcaatttc
ggcgccgccaagatcgcccagggagcggacgacatcgtcattgccggcggggtcgaatcg
atgtcgcgcgtcggcctcggcatgtcgggcggctcctggttcatggacccctccgtcaac
ctgccggcctatttcatgccgcagggcgtctcggccgacctgatcgccaccaaatacggt
ttctcgcgcgatgacgtcgatgcctatgcggtcgaaagccagaagcgcgccgcagatgcc
tgggaaaagggctatttcgagaactcggtcgtgccggtcaaggaccagaacggtctgacg
atcctcgaccgcgacgagcatatgcgtcccggcaccgacatgcaggcgctcgcctcgctc
aacccctccttccagatgcccggcgagatgggcggcttcgaggccgtcgccatccaggcg
catccggaaatcgagcggatcaactatgtccatcacgccggcaattcctccggcatcgtc
gacggcgctgcggcggtgctgctcggctcgaaggccggcggcgaatccatggggctgaag
ccgcgcgcccgcatacgcgccttcgccaatatcggctccgatccagcgctgatgctgacc
ggcccggtcgacgtcacggaaaagctcttgaagcgcgccgacatgaagctttccgacatc
gatctcttcgagctcaacgaggcctttgccgccgtggtgctgcgcttcatgcaggcgttc
gacattgcgcatgaccggatcaacgtcaatggcggcgcgatcgccatgggccatccgctc
ggcgcgaccggcgcgatgatcctcggcaccgtgctcgacgagctcgagcgccgcgacctc
aacacggcgctggtgacgctctgcatcggcgcgggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system