KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch0934Help
Entry
SAMCFNEI73_Ch0934 CDS       T04621                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
same  Sinorhizobium americanum
Pathway
same00071  Fatty acid degradation
same00072  Synthesis and degradation of ketone bodies
same00280  Valine, leucine and isoleucine degradation
same00310  Lysine degradation
same00362  Benzoate degradation
same00380  Tryptophan metabolism
same00620  Pyruvate metabolism
same00630  Glyoxylate and dicarboxylate metabolism
same00640  Propanoate metabolism
same00650  Butanoate metabolism
same00900  Terpenoid backbone biosynthesis
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
same01130  Biosynthesis of antibiotics
same01200  Carbon metabolism
same01212  Fatty acid metabolism
same02020  Two-component system
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMCFNEI73_Ch0934 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMCFNEI73_Ch0934 (vraB)
   00640 Propanoate metabolism
    SAMCFNEI73_Ch0934 (vraB)
   00650 Butanoate metabolism
    SAMCFNEI73_Ch0934 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMCFNEI73_Ch0934 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAMCFNEI73_Ch0934 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMCFNEI73_Ch0934 (vraB)
   00310 Lysine degradation
    SAMCFNEI73_Ch0934 (vraB)
   00380 Tryptophan metabolism
    SAMCFNEI73_Ch0934 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMCFNEI73_Ch0934 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMCFNEI73_Ch0934 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMCFNEI73_Ch0934 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:same04147]
    SAMCFNEI73_Ch0934 (vraB)
Enzymes [BR:same01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMCFNEI73_Ch0934 (vraB)
Exosome [BR:same04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMCFNEI73_Ch0934 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APG90256
UniProt: A0A1L3LJN9
Position
complement(961686..962879)
Genome map
AA seq 397 aa AA seqDB search
MNASSDPTRTPVVIAALRTPIGRVNGSLAAIEPASLAALLIDRIVSDVGINRNEIDDVLL
GNAANSAGNLARLAALEAGLPVSIPGVTVDRQCGSGLEAIVLAARQVQAGAGQYYLAGGT
ESASRAHIRLRPPLARGEELQPVKRARMAPDFIGDPDMGVAAENVATACGISRERQDQFA
LESHRRAVAAQITGRFAREIVPVETPTGPVANDDCPRANASAETLARLKPVFVRDGTVTA
GNACPINDGAAVVLVTSLAAARRLGVPFALEFIDAATAGVDPNLLGLGPVPAMARLRARN
PTLDIDKVDFIEFNEAFASQVLGSLDPLGISPERVNRDGGAIALGHPYGASGAILVVRLF
SQMLAAVTKSEGLAMMGVGGGMGAVAHFRSLRVRHTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcctcttctgatcccacccgcacaccggtcgtcatcgcggcgctacgcacgccg
atcggtcgcgtcaacggcagtctcgccgcgatcgagcccgcaagccttgccgccctgctg
atcgatcgcatcgtctcggacgttggtatcaatcggaacgagatcgacgacgtgcttctc
ggcaatgccgcaaacagcgccggcaatctcgcgcggcttgccgccctcgaagccggcctg
cctgtttccattcccggcgtcaccgtcgaccgccaatgcggctccgggctcgaagcgatc
gtccttgcggcgcggcaggtccaggccggcgccggtcaatactatctcgccggaggcacc
gaaagcgccagtcgcgcccatatccggcttcggccgccgctcgcacgtggggaagaactc
cagccggtgaaacgcgcgcggatggcgcccgattttattggcgatccggatatgggtgtt
gcggcggagaacgtcgccacggcgtgcgggatttcgcgggagcgtcaggaccagtttgcg
ctcgaaagtcatcgtcgtgccgtggctgcccagattacgggccgctttgcgcgcgagatc
gttccagtggaaacgccgaccggccccgtcgcaaacgacgactgcccgcgggccaatgcc
tcagccgagacgctcgcccggctgaagccggtctttgtcagggacggcaccgtcacagcg
ggcaatgcctgcccgatcaatgacggtgcggcagtcgtgctggtgacctcgctcgccgca
gcgcgtcggcttggcgtgccctttgcactcgaattcatcgacgcggcgacggcgggcgtc
gatccgaacctcctcggcctcggcccggtgccggcaatggcgaggcttcgggcccgcaat
ccgacgctcgacatcgacaaagtagacttcatcgagttcaacgaggccttcgcctcgcag
gtcctcggcagcctcgatccgctcggcatttcgccggagcgcgtcaatcgcgatggcggc
gcgatcgcgctgggtcatccctatggagcctcgggcgcgattctcgtcgtcaggctgttt
tcccagatgctcgccgcagtgaccaagagcgagggtctggcgatgatgggtgtcggcggc
ggcatgggcgcggtcgcccatttccgctcgctgagagtgcgtcacaccgcatag

DBGET integrated database retrieval system