KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch3245Help
Entry
SAMCFNEI73_Ch3245 CDS       T04621                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase LtaE
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
same  Sinorhizobium americanum
Pathway
same00260  Glycine, serine and threonine metabolism
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
same01130  Biosynthesis of antibiotics
same01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMCFNEI73_Ch3245 (ltaE)
Enzymes [BR:same01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAMCFNEI73_Ch3245 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APG92508
UniProt: A0A1L3LQY5
Position
3251072..3252127
Genome map
AA seq 351 aa AA seqDB search
MIPMIFASDNWAGAHPAISENLAAHVHGYVSAYGTSELDRKVEERLSEIFERDVAVFFVG
TGTAANALALASTNRAGGIAFCHREAHVNVDECGAPEFFSHGARLCPVDGARGKMDAARL
EAEIRRFPPDVVHGGQPMAVTLTQATESGTVYSLAEIEAVASIAKSHKLPLHMDGARFAN
ALVSLDTTPAEMTWKRGVDLLSFGGTKNGCWCAEALILFDPAKTHEMHFLRKRAAQLFSK
SRFIAAQFDAYLKGDLWLDLARHANSMARRLAEGIAASAVSRLAWTPGANEVFVILKRDV
AARLEEQGAVFYDWPAPQDLAASLAADEGLYRLVTSFATRADEVDQFIAAC
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgattccgatgatatttgcgtccgacaactgggctggcgctcatccggccatttccgaa
aacctcgccgcccatgtgcacggctatgtttccgcctacggcacgagcgaactcgaccgg
aaggtcgaagagcgcctgtcggagattttcgaaagggacgtcgcggtgtttttcgtcggc
accggcacggcggccaacgcgcttgcgctggcgagcaccaatcgggccggaggtatcgcc
ttctgccaccgcgaagcgcatgtgaacgtcgacgaatgcggtgcgccggaattcttctcg
catggcgccaggctctgcccggtcgacggcgcgcgcggcaagatggatgcggcgcggctc
gaagccgagatccgccgctttccgccggacgtcgtgcatggcggccagcccatggcggtg
acactgacgcaggcgaccgagagcggcacggtctattcgctcgcggaaatcgaagcggtc
gcctcgatcgccaaatcgcacaagctgccgctgcacatggacggcgcgcgcttcgccaat
gccctggtcagcctcgacactaccccggccgagatgacctggaagcgcggtgtcgacctt
ctatccttcggcggcacgaagaatggctgctggtgcgccgaggcgctcatcctcttcgac
cccgcgaagacgcacgagatgcatttcctgcgcaagcgcgcggcccagctcttctcgaaa
tcccgcttcatcgccgcccagttcgacgcgtatctcaaaggggacttgtggctcgacctc
gcccgccatgcgaatagcatggcacggcgccttgcggagggaatcgcggcttcggccgtg
agtcggctcgcctggacgccgggggccaacgaagtcttcgtgatcctgaagcgcgacgtg
gccgcgcgtctcgaagagcagggggcggtcttctacgactggccggcgccgcaagatctc
gccgccagcctcgccgcggatgaaggtctctaccgcctcgtcacgagcttcgccacgcgg
gccgatgaggtcgaccagttcatcgcggcctgctga

DBGET integrated database retrieval system