KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch3600Help
Entry
SAMCFNEI73_Ch3600 CDS       T04621                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
same  Sinorhizobium americanum
Pathway
same00790  Folate biosynthesis
same01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAMCFNEI73_Ch3600 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:same04147]
    SAMCFNEI73_Ch3600 (phhB)
Enzymes [BR:same01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SAMCFNEI73_Ch3600 (phhB)
Exosome [BR:same04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMCFNEI73_Ch3600 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: APG92850
UniProt: A0A1L3LRY6
Position
complement(3615812..3616129)
Genome map
AA seq 105 aa AA seqDB search
MRPEKLDAVAIAEHLHGMEGWVLAEDGASIWKAFRFRNFAEAFSFMTQCALAAEKLNHHP
EWFNVYNRVDVTLSTHDASGLTELDFKLAAKMDQAAAGRMPDHLK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctgaaaagctcgatgccgtagccatcgccgaacatctgcacgggatggaaggc
tgggttctcgccgaggatggggcctcgatttggaaggcgtttcgcttccgcaatttcgcc
gaagccttcagcttcatgacgcaatgcgctctcgcggcggagaagctcaaccaccatccg
gaatggttcaatgtctacaacagggtcgatgtcacgctttcgacgcatgatgccagcggt
ctgacggagcttgacttcaagctggcggcgaagatggaccaggcggccgccggccggatg
ccggatcatctgaaatag

DBGET integrated database retrieval system