KEGG   Staphylococcus aureus MS4: NI36_02335Help
Entry
NI36_02335        CDS       T04800                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sams  Staphylococcus aureus MS4
Pathway
sams00450  Selenocompound metabolism
sams00970  Aminoacyl-tRNA biosynthesis
sams01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sams00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NI36_02335
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NI36_02335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sams01007]
    NI36_02335
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sams03016]
    NI36_02335
Enzymes [BR:sams01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NI36_02335
Amino acid related enzymes [BR:sams01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NI36_02335
Transfer RNA biogenesis [BR:sams03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NI36_02335
 Prokaryotic type
   Other AARSs
    NI36_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d ARL2_Bind_BART PilM T4_neck-protein
Motif
Other DBs
NCBI-ProteinID: ALQ98742
UniProt: A0A168H6V3
Structure
PDB: 

Position
507835..509808
Genome map
AA seq 657 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYL
GEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVELVKEESYFFNISKYTDR
LLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDA
LVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDL
ANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVA
LSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPK
EIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRLDSEAEIAYIKESMQPPAT
EEEKEEIPSKPQIDIKDFDKVEIKAATIIDAEHVKKSDKLLKIQVDLDSEQRQIVSGIAK
FYTPDDIIGKKVAVVTNLKPAKLMGQKSEGMILSAEKDGVLTLVSLPSAIPNGAVIK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacattttatataacaaccccaatatactatcctagtgggaatttacat
ataggacatgcatattctacagtggctggagatgttattgcaagatataagagaatgcaa
ggatatgatgttcgttatttgactggaacggatgaacacggtcaaaaaattcaagaaaaa
gctcaaaaagctggtaagacagaaattgaatatttggatgagatgattgctggaattaaa
caattgtgggctaagcttgaaatttcaaatgatgattttatcagaacaactgaagaacgt
cataaacatgtcgttgagcaagtatttgaacgtttattaaagcaaggtgatatctattta
ggtgaatatgaaggttggtattctgttccggatgaaacatactacacagagtcacaatta
gtagacccacaatacgaaaacggtaaaattattggtggtaaaagtccagattctggacat
gaagttgaactagtaaaagaagaaagttatttctttaatattagtaaatatacagaccgt
ctattagaattctatgaccaaaatccagattttatacaaccaccatcaagaaaaaatgaa
atgattaacaacttcattaagccaggacttgctgatttggctgtttctcgtacatcattt
aactggggtgtccatgttccgtctaatccaaaacatgttgtttatgtttggattgatgcg
ttagttaactatatttcagcattaggctatttatcagatgatgagtcactatttaacaaa
tactggccagcagatattcatttaatggctaaggaaattgtgcgattccactcaattatt
tggcctattttattgatggcattagacttaccgttacctaaaaaagtctttgcacatggt
tggattttgatgaaagatggaaaaatgagtaaatctaaaggtaatgtcgtagacccgaat
attttaattgatcgctatggtttagatgccacacgttattatctaatgcgtgaattacca
tttggttcagatggcgtatttacacctgaagcatttgttgagcgtacaaatttcgatcta
gcaaatgacttaggcaacttagtaaaccgtacgatttctatgattaataagtactttgat
ggcgaattaccagcgtatcaaggtccacttcatgaattagatgaagaaatggaagctatg
gctttagaaacagtgaaaagctatactgaaagcatggaaagtttgcaattttctgtggca
ttatctacggtatggaagtttattagtagaacgaataagtatattgacgaaacaacgcct
tgggtattagctaaggacgatagccaaaaagatatgttaggcaatgttatggctcactta
gttgaaaatattcgttatgcagctgtattattacgtccattcttaactcatgcgccgaaa
gagatttttgaacaattgaacattaacaatcctcaatttatggaatttagtagtttagag
caatatggtgtgcttactgagccaattatggttactgggcaacctaaacctattttccca
agattggatagcgaagcggaaattgcatatatcaaagaatcaatgcaaccgcctgctact
gaagaggaaaaagaagagattcctagcaaaccacaaattgatattaaagactttgataaa
gttgaaattaaggcagcaacgattattgatgctgaacatgttaagaagtcagataagctt
ttaaaaattcaagtagacttagattctgaacaaagacaaattgtatcaggaattgccaaa
ttctatacaccagatgatattattggtaaaaaagtagcagttgttactaacttgaaacca
gctaaattaatggggcaaaaatctgaaggtatgatattatctgctgaaaaagatggtgta
ttaaccttagtaagtttaccaagtgcaattccaaatggtgcagtgattaaataa

DBGET integrated database retrieval system