KEGG   Staphylococcus aureus MS4: NI36_02865Help
Entry
NI36_02865        CDS       T04800                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sams  Staphylococcus aureus MS4
Pathway
sams00071  Fatty acid degradation
sams00072  Synthesis and degradation of ketone bodies
sams00280  Valine, leucine and isoleucine degradation
sams00310  Lysine degradation
sams00362  Benzoate degradation
sams00380  Tryptophan metabolism
sams00620  Pyruvate metabolism
sams00630  Glyoxylate and dicarboxylate metabolism
sams00640  Propanoate metabolism
sams00650  Butanoate metabolism
sams00900  Terpenoid backbone biosynthesis
sams01100  Metabolic pathways
sams01110  Biosynthesis of secondary metabolites
sams01120  Microbial metabolism in diverse environments
sams01130  Biosynthesis of antibiotics
sams01200  Carbon metabolism
sams01212  Fatty acid metabolism
sams02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NI36_02865
   00630 Glyoxylate and dicarboxylate metabolism
    NI36_02865
   00640 Propanoate metabolism
    NI36_02865
   00650 Butanoate metabolism
    NI36_02865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NI36_02865
   00072 Synthesis and degradation of ketone bodies
    NI36_02865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NI36_02865
   00310 Lysine degradation
    NI36_02865
   00380 Tryptophan metabolism
    NI36_02865
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NI36_02865
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NI36_02865
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI36_02865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sams04147]
    NI36_02865
Enzymes [BR:sams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NI36_02865
Exosome [BR:sams04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NI36_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALQ98830
Position
625838..626977
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGQFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggaggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatatagcaagaaaagcattgcttgaagcggggctcaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgtatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
caatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system