KEGG   Staphylococcus aureus MS4: NI36_06495Help
Entry
NI36_06495        CDS       T04800                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sams  Staphylococcus aureus MS4
Pathway
sams00260  Glycine, serine and threonine metabolism
sams01100  Metabolic pathways
sams01110  Biosynthesis of secondary metabolites
sams01120  Microbial metabolism in diverse environments
sams01130  Biosynthesis of antibiotics
sams01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sams00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NI36_06495
Enzymes [BR:sams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NI36_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALQ99522
Position
complement(1331378..1332403)
Genome map
AA seq 341 aa AA seqDB search
MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDCPNATIRFLVG
GTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEGKVSASDVETY
METFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPLFMDGARLGYG
LMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRIKHHGALLAKG
RLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFINKGYRLYFDSPTNQQFFILSNEKIA
ELEQKVKFAVWEKYDDQHRVVRFATSWATTEEILNKLLELI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcattcgaaaatgattatttagaaggtgctcatgaaaaagtattaaaacgatta
gtagatacaaatcttgtacaagcttcgggatatggctttgatcaattcacagctcaggca
attgaaaagattaaagatacaattgactgtccaaatgctactattcgttttttagtaggt
ggaacacaaaccaatcaggttgttattaattcaatgttagaaagttacgaaggggtcatt
tcagcagacactggtcatgttgctgtacatgaaggtggtgcaattgaatatagtggacat
aaagtaattactataccatctaaggaaggaaaagttagtgcttcagatgttgaaacttac
atggagacatttaaaagtgattttaaaaaggaccatatggtattcccaggaatggtatat
atttctcatcctacagaatatggcacattatactctaaatcagaattggaagagttatgt
aaagtatgtaagcaatatcagcttccattatttatggatggtgcacgattagggtatgga
ttgatgagtgaccaatcagacatgactattaaagatatcgctaaatattgtgatgtattt
tatataggtggtacgaagattggtgcactttgcggagaagctattgttttcacaaaaaat
aatgaaccgaaacaatttaccactcgaatcaaacatcacggtgcccttttagcaaaagga
cggttaacaggcatacaatttttagaattatttacggataatttatattttaatataagc
agacatgctatcgaaatggcaaataagatgaaagacgggtttataaataaaggctatcgt
ctttactttgattctccaaccaatcaacaattttttattttaagtaacgagaaaatagca
gagttagaacaaaaagttaaatttgctgtttgggaaaaatacgatgatcaacatcgtgtt
gttagattcgcaaccagctgggcgacaaccgaagaaattttaaataaactattagaatta
atctaa

DBGET integrated database retrieval system